MEIKIN Meiosis-specific kinetochore protein

• Overview
• Annotations

UniProt Data

Enzyme Annotations (0)

GO Annotations

Cellular component (2)

• GO:0000777 Condensed chromosome kinetochore
  A multisubunit complex that is located at the centromeric region of a condensed chromosome and provides an attachment point for the spindle microtubules.
• GO:0000780 Condensed nuclear chromosome, centromeric region
  The region of a condensed nuclear chromosome that includes the centromere and associated proteins, including the kinetochore. In monocentric chromosomes, this region corresponds to a single area of the chromosome, whereas in holocentric chromosomes, it is evenly distributed along the chromosome.

Molecular function (1)

Biological process (5)

• GO:0007060 Male meiosis chromosome segregation
  The cell cycle process in which genetic material, in the form of chromosomes, is organized and then physically separated and apportioned to two or more sets during the meiotic cell cycle in a male.
• GO:0010789 Meiotic sister chromatid cohesion involved in meiosis I
  The cell cycle process in which sister chromatids of a replicated chromosome are joined along the entire length of the chromosome during meiosis I.
• GO:0016321 Female meiosis chromosome segregation
  The cell cycle process in which genetic material, in the form of chromosomes, is organized and then physically separated and apportioned to two or more sets during the meiotic cell cycle in a female.
• GO:0045143 Homologous chromosome segregation
  The cell cycle process in which replicated homologous chromosomes are organized and then physically separated and apportioned to two sets during the first division of the meiotic cell cycle. Each replicated chromosome, composed of two sister chromatids, aligns at the cell equator, paired with its homologous partner; this pairing off, referred to as synapsis, permits genetic recombination. One homolog (both sister chromatids) of each morphologic type goes into each of the resulting chromosome sets.
• GO:0051754 Meiotic sister chromatid cohesion, centromeric
  The cell cycle process in which centromeres of sister chromatids are joined during meiosis.

Protein Sequence

>A0A087WXM9
MWPLRVYTRKKREGQRLNLTPTPDLGSPAKAEAPPGSKRKGKVHGLSKIAEKAERSRQGGSGSGPFSPRLGVTGEKSLQE
NRSSEDTQDEKIASLRESVTDDLQVDSSSSNSELVSGLSLHHGMASSLLSYSVTDSYAEYKSFEESFPSPELFRKSDYLD
WECPNLEEHMQWKNSTLLDTSKAVAIEKAPQFSNVSAIFSTSSEDYQKCHRKTVMTVADQNVSPKAKCASNSESDNAACE
ILLAEKTCPSTPEKTKKKKTNSSTPGKKNRGLLTSTPSSETAGFVIDLSSVQKASFEELFPNVSNYVNSNEIVPVSSLQE
NSSNEFPANASEICCIIRTSPGTRQVKNKGVIVKKKKYSLPKDTPQDIIIKMA