CYP2D7 Putative cytochrome P450 2D7
UniProt Data
Accession | A0A087X1C5 [ UniProt ] |
Name | CP2D7_HUMAN |
Description | Putative cytochrome P450 2D7 |
Species | Homo sapiens |
Sequence Length | 515 |
Enzyme Annotations (1)
- EC:1.14.14.1 Unspecific monooxygenase.
RH + [reduced NADPH--hemoprotein reductase] + O(2) = ROH + [oxidized NADPH--hemoprotein reductase] + H(2)O.
GO Annotations
Cellular component (2)
- GO:0005737 Cytoplasm
All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. - GO:0005739 Mitochondrion
A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
Molecular function (1)
None predictedBiological process (2)
- GO:0006805 Xenobiotic metabolic process
The chemical reactions and pathways involving a xenobiotic compound, a compound foreign to living organisms. Used of chemical compounds, e.g. a xenobiotic chemical, such as a pesticide. - GO:0042738 Exogenous drug catabolic process
The chemical reactions and pathways resulting in the breakdown of a drug that has originated externally to the cell or organism.
Protein Sequence
>A0A087X1C5 MGLEALVPLAMIVAIFLLLVDLMHRHQRWAARYPPGPLPLPGLGNLLHVDFQNTPYCFDQLRRRFGDVFSLQLAWTPVVV LNGLAAVREAMVTRGEDTADRPPAPIYQVLGFGPRSQGVILSRYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEAACL CAAFADQAGRPFRPNGLLDKAVSNVIASLTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLPHIPALAGKV LRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAKKEKAKGSPESSFNDENLRIVVGNLFLAGMVTTSTTLAWGLLL MILHLDVQRGRRVSPGCPIVGTHVCPVRVQQEIDDVIGQVRRPEMGDQAHMPCTTAVIHEVQHFGDIVPLGVTHMTSRDI EVQGFRIPKGTTLITNLSSVLKDEAVWKKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQ HFSFSVAAGQPRPSHSRVVSFLVTPSPYELCAVPR