Fcgr4 Low affinity immunoglobulin gamma Fc region receptor IV
UniProt Data
| Accession | A0A0B4J1G0 [ UniProt ] |
| Name | FCGR4_MOUSE |
| Description | Low affinity immunoglobulin gamma Fc region receptor IV |
| Species | Mus musculus |
| Sequence Length | 249 |
Enzyme Annotations (0)
GO Annotations
Cellular component (3)
- GO:0009897 External side of plasma membrane
The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface. - GO:0009986 Cell surface
The external part of the cell wall and/or plasma membrane. - GO:0070062 Extracellular exosome
A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
Molecular function (2)
- GO:0019767 IgE receptor activity
Combining with an immunoglobulin of the IgE isotype via the Fc region, and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity. - GO:0019770 IgG receptor activity
Combining with an immunoglobulin of an IgG isotype via the Fc region, and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
Biological process (2)
- GO:0042119 Neutrophil activation
The change in morphology and behavior of a neutrophil resulting from exposure to a cytokine, chemokine, cellular ligand, or soluble factor. - GO:0045780 Positive regulation of bone resorption
Any process that activates or increases the frequency, rate or extent of bone resorption.
Protein Sequence
>A0A0B4J1G0 MWQLLLPTALVLTAFSGIQAGLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQDANYVIQSARV KDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEGDPIHLRCHSWQNRPVRKVTYLQNGKGKKYFHENSELLIPK ATHNDSGSYFCRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQITFCLLIGLLFAIDTVLYFSVRRGLQSPVADYEEPKI QWSKEPQDK
