DUO1 DUO1

• Overview
• Annotations

UniProt Data

Enzyme Annotations (0)

GO Annotations

Cellular component (1)

Molecular function (2)

• GO:0003700 Transcription factor activity, sequence-specific DNA binding
  Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
• GO:0043565 Sequence-specific DNA binding
  Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.

Biological process (5)

• GO:0044839 Cell cycle G2/M phase transition
  The cell cycle process by which a cell in G2 phase commits to M phase.
• GO:0045893 Positive regulation of transcription, DNA-templated
  Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
• GO:0048235 Pollen sperm cell differentiation
  The process in which a relatively unspecialized cell acquires specialized features of a haploid sperm cell within the plant gametophyte.
• GO:0048235 Pollen sperm cell differentiation
  The process in which a relatively unspecialized cell acquires specialized features of a haploid sperm cell within the plant gametophyte.
• GO:0055047 Generative cell mitosis
  The process in which the generative cell divides by mitosis to form two haploid cells. These will subsequently differentiate into sperm cells.

Protein Sequence

>A0A178VEK7
MRKMEAKKEEIKKGPWKAEEDEVLINHVKRYGPRDWSSIRSKGLLQRTGKSCRLRWVNKLRPNLKNGCKFSADEERTVIE
LQSEFGNKWARIATYLPGRTDNDVKNFWSSRQKRLARILHNSSDASSSSFNPKSSSSHRLKGKNVKPIRQSSQGFGLVEE
EVTVSSSCSQMVPYSSDQVGDEVLRLPDLGVKLEHQPFAFGTDLVLAEYSDSQNDANQQAISPFSPESRELLARLDDPFY
YDILGPADSSEPLFALPQPFFEPSPVPRRCRHVSKDEEADVFLDDFPADMFDQVDPIPSP