Mus musculus

UniProt Data

Accession A0PK84 [ UniProt ]
Name ZDH22_MOUSE
Description Palmitoyltransferase ZDHHC22
Species Mus musculus
Sequence Length263

Enzyme Annotations (1)

  • EC:2.3.1.225 Protein S-acyltransferase.
    Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA.

GO Annotations

Cellular component (2)

  • GO:0005783 Endoplasmic reticulum
    The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
  • GO:0005794 Golgi apparatus
    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.

Molecular function (1)

None predicted

Biological process (2)

  • GO:0018345 Protein palmitoylation
    The covalent attachment of a palmitoyl group to a protein.
  • GO:0072659 Protein localization to plasma membrane
    A process in which a protein is transported to, or maintained in, a specific location in the plasma membrane.

Protein Sequence

>A0PK84
MLALRLLNVVAPAYFLCISLVTFVLQLFLFLPSMREDPTATPLFSPAVLHGALFLFLSANALGNYVLVIQNSPDDLGTCQ
GTMSQRPQCPPPSTHFCRVCSRVTLRHDHHCFFTGNCIGSRNMRNFILFCLYTSLACLYSMVAGVAYISAVLSISFAHPL
AFLTLLPTSISQFFSGAVLGSDMFVILMLYLWFAVGLACAGFCCHQLLLILRGQTRYQVRKGMAVRARPWRKNLQEVFGK
RWLLGLLVPMFNVGTESSKQQDK