Pglyrp3 Peptidoglycan recognition protein 3
UniProt Data
Accession | A1A547 [ UniProt ] |
Name | PGRP3_MOUSE |
Description | Peptidoglycan recognition protein 3 |
Species | Mus musculus |
Sequence Length | 347 |
Enzyme Annotations (0)
GO Annotations
Cellular component (1)
None predictedMolecular function (3)
- GO:0016019 Peptidoglycan receptor activity
Combining with a peptidoglycan and transmitting the signal to initiate a change in cell activity. - GO:0042834 Peptidoglycan binding
Interacting selectively and non-covalently, in a non-covalent manner, with peptidoglycan, any of a class of glycoconjugates found in bacterial cell walls. - GO:0042834 Peptidoglycan binding
Interacting selectively and non-covalently, in a non-covalent manner, with peptidoglycan, any of a class of glycoconjugates found in bacterial cell walls.
Biological process (5)
- GO:0016045 Detection of bacterium
The series of events in which a stimulus from a bacterium is received and converted into a molecular signal. - GO:0032689 Negative regulation of interferon-gamma production
Any process that stops, prevents, or reduces the frequency, rate, or extent of interferon-gamma production. Interferon-gamma is also known as type II interferon. - GO:0032827 Negative regulation of natural killer cell differentiation involved in immune response
Any process that stops, prevents, or reduces the frequency, rate or extent of natural killer cell differentiation as part of an immune response. - GO:0044117 Growth of symbiont in host
The increase in size or mass of an organism, occurring within the cells or tissues of the host organism. This may (but not necessarily) include a filamentous growth form, and also can include secretion of proteases and lipases to break down host tissue. The host is defined as the larger of the organisms involved in a symbiotic interaction. - GO:0050830 Defense response to Gram-positive bacterium
Reactions triggered in response to the presence of a Gram-positive bacterium that act to protect the cell or organism.
Protein Sequence
>A1A547 MLVSWDHPKMLPRLLGFLALSLLACGNPTIVSRKEWGASSLTCRVPLSLPVPYLIIEQVTRMQCQDQITCSQVVRVLQSQ YVHNKGWCDIAFNFLVGDDGKVYEGVGWYVQGLHTQGYNNVSLGIAFFGSKIGSPSPAALSATEDLIFFAIQNGYLSPKY IQPFLLKEETCLVPQHSEIPKKACPNITPRSAWEARETHCPQMNLPAKFVIIIHTAGKSCNESADCLVRVRDTQSFHIDN QDFCDIAYHFLVGQDGEVYEGVGWNIEGSHTYGYNDIALGIAFMGNFVEKPPNEASLKAAQSLIQCAVAKGYLTSNYLLM GHSDVSNILSPGQALYNIIKTWPHFKH