Odam Odontogenic ameloblast-associated protein
UniProt Data
Accession | A1E960 [ UniProt ] |
Name | ODAM_MOUSE |
Description | Odontogenic ameloblast-associated protein |
Species | Mus musculus |
Sequence Length | 273 |
Enzyme Annotations (0)
GO Annotations
Cellular component (8)
- GO:0005576 Extracellular region
The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite. - GO:0005615 Extracellular space
That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid. - GO:0005634 Nucleus
A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent. - GO:0005634 Nucleus
A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent. - GO:0005737 Cytoplasm
All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. - GO:0005737 Cytoplasm
All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. - GO:0071944 Cell periphery
The part of a cell encompassing the cell cortex, the plasma membrane, and any external encapsulating structures. - GO:0099512 Supramolecular fiber
A polymer consisting of an indefinite number of protein or protein complex subunits that have polymerised to form a fiber-shaped structure.
Molecular function (1)
None predictedBiological process (6)
- GO:0001934 Positive regulation of protein phosphorylation
Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein. - GO:0006954 Inflammatory response
The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages. - GO:0009611 Response to wounding
Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to the organism. - GO:0010628 Positive regulation of gene expression
Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA (for protein-coding genes) and the translation of that mRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form. - GO:0032956 Regulation of actin cytoskeleton organization
Any process that modulates the frequency, rate or extent of the formation, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins. - GO:0043547 Positive regulation of GTPase activity
Any process that activates or increases the activity of a GTPase.
Protein Sequence
>A1E960 MKIIILLGLIGASSSAPLISQRLLSASNSHELLLNLNNGQLLPLQFQGAFNSWIPPFPGFLQQQQAQVSGRPQFTLSTLE SFAGLFPNQIPLSRQVGLAQGGQAGQPDLSQQQTPPQTQQSASPMSYVVPVKVPQDQTQMFQYYPVYMLLPWEQPQTVTS SPQHTGQQLFEEQIPFYNQFGFAPPQAEPGVPGGQQHLAFDSFVGTAPETPGMPVEGSLLYPQKEPISFKHDNAGVFMPT TSPKPSTDNFFTSGIDPTIAPEQKVKTDSLREP