Mus musculus

UniProt Data

Accession A1KXC4 [ UniProt ]
Name FAIM3_MOUSE
Description Fas apoptotic inhibitory molecule 3
Species Mus musculus
Sequence Length422

Enzyme Annotations (0)

    GO Annotations

    Cellular component (2)

    • GO:0009897 External side of plasma membrane
      The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    • GO:0009986 Cell surface
      The external part of the cell wall and/or plasma membrane.

    Molecular function (1)

    None predicted

    Biological process (3)

    • GO:0070229 Negative regulation of lymphocyte apoptotic process
      Any process that stops, prevents, or reduces the frequency, rate or extent of lymphocyte death by apoptotic process.
    • GO:1990001 Inhibition of cysteine-type endopeptidase activity involved in apoptotic process
      Any process that prevents the activation of an inactive cysteine-type endopeptidase involved in an apoptotic process.
    • GO:2001237 Negative regulation of extrinsic apoptotic signaling pathway
      Any process that stops, prevents or reduces the frequency, rate or extent of extrinsic apoptotic signaling pathway.

    Protein Sequence

    >A1KXC4
    MDFWLWLLYFLPVSGALRVLPEVQLNVEWGGSIIIECPLPQLHVRMYLCRQMAKPGICSTVVSNTFVKKEYERRVTLTPC
    LDKKLFLVEMTQLTENDDGIYACGVGMKTDKGKTQKITLNVHNEYPEPFWEDEWTSERPRWLHRFLQHQMPWLHGSEHPS
    SSGVIAKVTTPAPKTEAPPVHQPSSITSVTQHPRVYRAFSVSATKSPALLPATTASKTSTQQAIRPLEASYSHHTRLHEQ
    RTRHHGPHYGREDRGLHIPIPEFHILIPTFLGFLLLVLLGLVVKRAIQRRRASSRRAGRLAMRRRGRGASRPFPTQRRDA
    SQRPRSQNNVYSACPRRARGPDSLGPAEAPLLNAPASASPASPQVLEAPWPHTPSLKMSCEYVSLGYQPAVNLEDPDSDD
    YINIPDPSHLPSYAPGPRSSCP