Fcmr Fas apoptotic inhibitory molecule 3
UniProt Data
Accession | A1KXC4 [ UniProt ] |
Name | FAIM3_MOUSE |
Description | Fas apoptotic inhibitory molecule 3 |
Species | Mus musculus |
Sequence Length | 422 |
Enzyme Annotations (0)
GO Annotations
Cellular component (2)
- GO:0009897 External side of plasma membrane
The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface. - GO:0009986 Cell surface
The external part of the cell wall and/or plasma membrane.
Molecular function (1)
None predictedBiological process (3)
- GO:0070229 Negative regulation of lymphocyte apoptotic process
Any process that stops, prevents, or reduces the frequency, rate or extent of lymphocyte death by apoptotic process. - GO:1990001 Inhibition of cysteine-type endopeptidase activity involved in apoptotic process
Any process that prevents the activation of an inactive cysteine-type endopeptidase involved in an apoptotic process. - GO:2001237 Negative regulation of extrinsic apoptotic signaling pathway
Any process that stops, prevents or reduces the frequency, rate or extent of extrinsic apoptotic signaling pathway.
Protein Sequence
>A1KXC4 MDFWLWLLYFLPVSGALRVLPEVQLNVEWGGSIIIECPLPQLHVRMYLCRQMAKPGICSTVVSNTFVKKEYERRVTLTPC LDKKLFLVEMTQLTENDDGIYACGVGMKTDKGKTQKITLNVHNEYPEPFWEDEWTSERPRWLHRFLQHQMPWLHGSEHPS SSGVIAKVTTPAPKTEAPPVHQPSSITSVTQHPRVYRAFSVSATKSPALLPATTASKTSTQQAIRPLEASYSHHTRLHEQ RTRHHGPHYGREDRGLHIPIPEFHILIPTFLGFLLLVLLGLVVKRAIQRRRASSRRAGRLAMRRRGRGASRPFPTQRRDA SQRPRSQNNVYSACPRRARGPDSLGPAEAPLLNAPASASPASPQVLEAPWPHTPSLKMSCEYVSLGYQPAVNLEDPDSDD YINIPDPSHLPSYAPGPRSSCP