Genome3D
Mus musculus

Tomt Transmembrane O-methyltransferase

UniProt Data

Accession A1Y9I9 [ UniProt ]
Name TOMT_MOUSE
Description Transmembrane O-methyltransferase
Species Mus musculus
Sequence Length258

Enzyme Annotations (1)

  • EC:2.1.1.6 Catechol O-methyltransferase.
    S-adenosyl-L-methionine + a catechol = S-adenosyl-L-homocysteine + a guaiacol.

GO Annotations

Cellular component (1)

None predicted

Molecular function (1)

None predicted

Biological process (3)

  • GO:0007605 Sensory perception of sound
    The series of events required for an organism to receive an auditory stimulus, convert it to a molecular signal, and recognize and characterize the signal. Sonic stimuli are detected in the form of vibrations and are processed to form a sound.
  • GO:0042424 Catecholamine catabolic process
    The chemical reactions and pathways resulting in the breakdown of any of a group of physiologically important biogenic amines that possess a catechol (3,4-dihydroxyphenyl) nucleus and are derivatives of 3,4-dihydroxyphenylethylamine.
  • GO:0060117 Auditory receptor cell development
    The process whose specific outcome is the progression of an auditory receptor cell over time, from its formation to the mature structure. Cell development does not include the steps involved in committing a cell to a specific fate.

Protein Sequence

>A1Y9I9
MSPAIALAFLPLVVTLLVRYRHHFRLLVRTVLLRGFRDCLSGLRIEERAFSYVLTHALPGDPGHILTTLDHWSSCCEYLS
HMGPVKGQILMRLVEEKAPACVLELGTYCGYSTLLIARALPPGSRLLTVERDSRTAAVAEKVIRLAGFDEQMVELIAGSS
EEVIPRLRAQHQLNRADLVLLAHRPRYYLRDLQLLEAHALLPHGATVLADHVLFPGAPRFLQYTKSCGRYRCRLHHTSLP
DFPAIKDGIAQLTYTGPG