Fcrl6 Fc receptor-like protein 6
UniProt Data
Accession | A1YIY0 [ UniProt ] |
Name | FCRL6_MOUSE |
Description | Fc receptor-like protein 6 |
Species | Mus musculus |
Sequence Length | 268 |
Enzyme Annotations (0)
GO Annotations
Cellular component (2)
- GO:0009897 External side of plasma membrane
The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface. - GO:0009897 External side of plasma membrane
The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
Molecular function (1)
None predictedBiological process (1)
None predictedProtein Sequence
>A1YIY0 MLLWMVLLLCESMAEAQELFPNPELTEFTNSETMDVILKCTIKVDPKNPTLQLFYTFYKNNHVIQDRSPHSVFSAEAKEE NSGLYQCMVDTEDGLIQKKSGYLDIQFWTPVSHPVLTLQHEATNLAVGDKVEFLCEAHQGSLPIFYSFYINGEILGKPLA PSGRAASLLASVKAEWSTKNYSCEAKNNISREISELKKFPLVVSGTAWIKSNMLPIWLPASLLGGMVIAAVVLMYFFKPC KKHARPETPTLKEPDSFLYVSVDNQRYK