Mus musculus

UniProt Data

Accession A1Z198 [ UniProt ]
Name NL1B2_MOUSE
Description NACHT, LRR and PYD domains-containing protein 1b allele 2
Species Mus musculus
Sequence Length1177

Enzyme Annotations (0)

    GO Annotations

    Cellular component (4)

    • GO:0005634 Nucleus
      A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    • GO:0005654 Nucleoplasm
      That part of the nuclear content other than the chromosomes or the nucleolus.
    • GO:0005829 Cytosol
      The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    • GO:0072558 NLRP1 inflammasome complex
      A protein complex that consists of two components, NLRP1 (NALP1) and caspase-1 or caspase-5. The exact mechanisms of NLRP1 activation remain obscure, but potassium ion efflux appears to be essential.

    Molecular function (3)

    • GO:0005524 ATP binding
      Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    • GO:0019899 Enzyme binding
      Interacting selectively and non-covalently with any enzyme.
    • GO:0019904 Protein domain specific binding
      Interacting selectively and non-covalently with a specific domain of a protein.

    Biological process (7)

    • GO:0006919 Activation of cysteine-type endopeptidase activity involved in apoptotic process
      Any process that initiates the activity of the inactive enzyme cysteine-type endopeptidase in the context of an apoptotic process.
    • GO:0030163 Protein catabolic process
      The chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
    • GO:0032610 Interleukin-1 alpha production
      The appearance of interleukin-1 alpha due to biosynthesis or secretion following a cellular stimulus, resulting in an increase in its intracellular or extracellular levels.
    • GO:0032611 Interleukin-1 beta production
      The appearance of interleukin-1 beta due to biosynthesis or secretion following a cellular stimulus, resulting in an increase in its intracellular or extracellular levels.
    • GO:0032611 Interleukin-1 beta production
      The appearance of interleukin-1 beta due to biosynthesis or secretion following a cellular stimulus, resulting in an increase in its intracellular or extracellular levels.
    • GO:0051402 Neuron apoptotic process
      Any apoptotic process in a neuron, the basic cellular unit of nervous tissue. Each neuron consists of a body, an axon, and dendrites. Their purpose is to receive, conduct, and transmit impulses in the nervous system.
    • GO:0070269 Pyroptosis
      A caspase-1-dependent cell death subroutine that is associated with the generation of pyrogenic mediators such as IL-1beta and IL-18.

    Protein Sequence

    >A1Z198
    MEESQYKQEHNKKVAQDEGQEDKDTIFETIEAIEAKLMELKTNPESTFNYGIFPEVYMNQGEEILYPAWSLKEENLFQTF
    KSLRLFQKLCPRGSGNLVKKSWYPCVPEEGGHIINIQDLFGPNIGTQKEPQLVIIEGAAGIGKSTLARQVKRAWMEGELY
    RDHFQHVFFFSCRELAQCKKLSLAELITQGQDVPTAPINQILSHPEKLLFILDGIDEPAWVLADQNPELCLYWSQTQPVH
    TLLGSLLGKSILPEASFLLTTRTTALQKFIPSLPQSCQVEVLGFSDFEQEIYIYKYFAKQIFGIKALMMVESNPVLLTLC
    EVPWVCWLVCNCLKKQMEQGGDVSLTSQTTTAICLKYISLTIPVHHMRTQLRALCSLAAEGIWKRRTLFSESDLCKQGLD
    EDAVAIFLKTGVLQKQASSLSYSFAHLCLQEFFASMSCILEDSEERHGDMEMDRIVETLVERYGRQNLFEAPTVRFLFGL
    LSKEGLKEMEKLFSCSLPGKTKLKLLWHILGKSQPHQPPCLGLLHCLYENQDMKLLTHVMHDLQGTIVPDTDDITHTVLQ
    TNVKHLVVRTDMELMVVTFCIQFCSHMRSLQLNMEGQQGYALTAPRMVLYRWTPITNASWKILFYNLKFNSNLEGLDLSG
    NPLSYSAVQYLCDAMIYPGCQLKTLWLVECGLTPTYCSLLASVLSACSSLRELDLQLNDLCDDGVRMLCEGLRNRACNLR
    ILRLDLYSLSAQVITELRTLEENNLKLHISSIWMPQMMVPTENMDEEDILTSFKQQRQQSGANPMEILGTEEDFWGPIGP
    VATEVVYRERNLYRVQLPMAGSYHCPSTRLHFVVTRAVTIEIEFCAWSQFLDKTPLQQSHMVVGPLFDIKAEQGAVTAVY
    LPHFVSLKDTKASTFDFKVAHFQEHGMVLETPDRVKPGYTVLKNPSFSPMGVVLRIIPAARHFIPITSITLIYYRVNQEE
    VTLHLYLVPNDCTIQKAIDDEEMKFQFVRINKPPPVDNLFIGSRYIVSGSENLEITPKELELCYRSSKEFQLFSEIYVGN
    MGSEIKLQIKNKKHMKLIWEALLKPGDLRPALPRIAQALKDAPSLLHFMDQHREQLVARVTSVDPLLDKLHGLVLNEESY
    EAVRAENTNQDKMRKLFNLSRSWSRACKDLFYQALKETHPHLVMDLLEKSGGVSLGS