Genome3D
Mus musculus

Cul4b Cullin-4B

UniProt Data

Accession A2A432 [ UniProt ]
Name CUL4B_MOUSE
Description Cullin-4B
Species Mus musculus
Sequence Length970

Enzyme Annotations (0)

    GO Annotations

    Cellular component (5)

    • GO:0005654 Nucleoplasm
      That part of the nuclear content other than the chromosomes or the nucleolus.
    • GO:0005829 Cytosol
      The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    • GO:0031465 Cul4B-RING E3 ubiquitin ligase complex
      A ubiquitin ligase complex in which a cullin from the Cul4B subfamily and a RING domain protein form the catalytic core; substrate specificity is conferred by unknown subunits.
    • GO:0031465 Cul4B-RING E3 ubiquitin ligase complex
      A ubiquitin ligase complex in which a cullin from the Cul4B subfamily and a RING domain protein form the catalytic core; substrate specificity is conferred by unknown subunits.
    • GO:0070062 Extracellular exosome
      A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

    Molecular function (1)

    None predicted

    Biological process (4)

    • GO:0035518 Histone H2A monoubiquitination
      The modification of histone H2A by addition of a single ubiquitin group.
    • GO:0045732 Positive regulation of protein catabolic process
      Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
    • GO:0070914 UV-damage excision repair
      A DNA repair process that is initiated by an endonuclease that introduces a single-strand incision immediately 5' of a UV-induced damage site. UV-damage excision repair acts on both cyclobutane pyrimidine dimers (CPDs) and pyrimidine-pyrimidone 6-4 photoproducts (6-4PPs).
    • GO:1900087 Positive regulation of G1/S transition of mitotic cell cycle
      Any cell cycle regulatory process that promotes the commitment of a cell from G1 to S phase of the mitotic cell cycle.

    Protein Sequence

    >A2A432
MSRSTRSKERRENDTDSEDNSSETSNQERRRCRQGPPRPPYPPLLPPVFPPPTPPPQVRRTRGLQDLGAMKSVCPGTSGF
SSPNPSAASAAAQEVRSATDGNTSTTPPTSAKKRKLNSSSSSSNSSNEREDFDSTSSSSTPPQPRDSASPSTSSFCLGVP
VATSSHVPIQKKLRFEDTLEFVGIDTKMAEESSSSSSSSSPTAATSQQQQQQQLKTKSILISSVASVHHANGLAKSSTAV
SSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISANLYKQLRQI
CEDHIKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYVLQNSMLPSIWDMGLELFRAHIISDQKVQ
TKTIDGILLLIERERNGEAIDRSLLRSLLSMLSDLQIYQDSFEQQFLQETNRLYAAEGQKLMQEREVPEYLHHVNKRLEE
EADRLITYLDQTTQKSLIASVEKQLLGEHLTAILQKGLNSLLDENRIQDLSLLYQLFSRVRGGVQVLLQQWIEYIKAFGS
TIVINPEKDKTMVQELLDFKDKVDHIIDTCFLKNEKFINAMKEAFETFINKRPNKPAELIAKYVDSKLRAGNKEATDEEL
EKMLDKIMIIFRFIYGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMFKDMELSKDIMIQFK
QYMQNQNVPGNIELTVNILTMGYWPTYVPMEVHLPPEMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKEL
QVSLFQTMVLLMFNEGEEFSLEEIKHATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKI
NQIQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYMERDK
ENPNQYNYIA