Pgap3 Post-GPI attachment to proteins factor 3
UniProt Data
| Accession | A2A559 [ UniProt ] |
| Name | PGAP3_MOUSE |
| Description | Post-GPI attachment to proteins factor 3 |
| Species | Mus musculus |
| Sequence Length | 320 |
Enzyme Annotations (0)
GO Annotations
Cellular component (2)
- GO:0031227 Intrinsic component of endoplasmic reticulum membrane
The component of the endoplasmic reticulum membrane consisting of the gene products and protein complexes having either part of their peptide sequence embedded in the hydrophobic region of the membrane or some other covalently attached group such as a GPI anchor that is similarly embedded in the membrane. - GO:0031227 Intrinsic component of endoplasmic reticulum membrane
The component of the endoplasmic reticulum membrane consisting of the gene products and protein complexes having either part of their peptide sequence embedded in the hydrophobic region of the membrane or some other covalently attached group such as a GPI anchor that is similarly embedded in the membrane.
Molecular function (2)
- GO:0016788 Hydrolase activity, acting on ester bonds
Catalysis of the hydrolysis of any ester bond. - GO:0016788 Hydrolase activity, acting on ester bonds
Catalysis of the hydrolysis of any ester bond.
Biological process (2)
- GO:0006505 GPI anchor metabolic process
The chemical reactions and pathways involving glycosylphosphatidylinositol anchors, molecular mechanisms for attaching membrane proteins to the lipid bilayer of cell membranes. Structurally they consist of a molecule of phosphatidylinositol to which is linked, via the C-6 hydroxyl of the inositol, a carbohydrate chain. This chain is in turn linked to the protein through an ethanolamine phosphate group, the amino group of which is in amide linkage with the C-terminal carboxyl of the protein chain, the phosphate group being esterified to the C-6 hydroxyl of the terminal mannose of the core carbohydrate chain. - GO:0006505 GPI anchor metabolic process
The chemical reactions and pathways involving glycosylphosphatidylinositol anchors, molecular mechanisms for attaching membrane proteins to the lipid bilayer of cell membranes. Structurally they consist of a molecule of phosphatidylinositol to which is linked, via the C-6 hydroxyl of the inositol, a carbohydrate chain. This chain is in turn linked to the protein through an ethanolamine phosphate group, the amino group of which is in amide linkage with the C-terminal carboxyl of the protein chain, the phosphate group being esterified to the C-6 hydroxyl of the terminal mannose of the core carbohydrate chain.
Protein Sequence
>A2A559 MAKRTAPLLLLTLAVGLAGGSQGDREPVYRDCVLRCEERNCSGDALKHFRSRQPIYMSLAGWTCRDDCKYECMWFTVGLY LQEGHRVPQFHGKWPFSRFLFIQEPASAVASLLNGLASLVMLCRYRASVPASSPMYHTCMAFAWVSLNAWFWSTVFHTRD TDLTEKMDYFCASAVILHSVYLCCVRTVGLQHPSVASAFGALLLLLLTGHISYLSLVHFDYGYNMMANVAIGLVNLAWWL VWCLRNRQRLPHTRRCMVVVVLLQGLSLLELLDFPPLFWVLDAHAIWHISTIPVHTLFFRFLEDDSLYLLKESGAMFKLD
