Mus musculus

UniProt Data

Accession A2A5H7 [ UniProt ]
Name WFD11_MOUSE
Description Protein WFDC11
Species Mus musculus
Sequence Length82

Enzyme Annotations (0)

    GO Annotations

    Cellular component (1)

    None predicted

    Molecular function (1)

    None predicted

    Biological process (1)

    None predicted

    Protein Sequence

    >A2A5H7
    MKPSWFPCLVFLCMLLLSALGGRKNKYYPGELLLEECWGQPKTNDCVKKCSRTFKCVYRNHTCCWTYCGNICAENGKFFE
    RK