Znf335 Zinc finger protein 335
UniProt Data
Accession | A2A5K6 [ UniProt ] |
Name | ZN335_MOUSE |
Description | Zinc finger protein 335 |
Species | Mus musculus |
Sequence Length | 1337 |
Enzyme Annotations (0)
GO Annotations
Cellular component (2)
- GO:0005634 Nucleus
A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent. - GO:0005654 Nucleoplasm
That part of the nuclear content other than the chromosomes or the nucleolus.
Molecular function (3)
- GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
Interacting selectively and non-covalently with the regulatory region composed of the transcription start site and binding sites for transcription factors of the RNA polymerase II basal transcription machinery. - GO:0005515 Protein binding
Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules). - GO:0044212 Transcription regulatory region DNA binding
Interacting selectively and non-covalently with a DNA region that regulates the transcription of a region of DNA, which may be a gene, cistron, or operon. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
Biological process (19)
- GO:0001701 In utero embryonic development
The process whose specific outcome is the progression of the embryo in the uterus over time, from formation of the zygote in the oviduct, to birth. An example of this process is found in Mus musculus. - GO:0002052 Positive regulation of neuroblast proliferation
Any process that activates or increases the rate of neuroblast proliferation. - GO:0007420 Brain development
The process whose specific outcome is the progression of the brain over time, from its formation to the mature structure. Brain development begins with patterning events in the neural tube and ends with the mature structure that is the center of thought and emotion. The brain is responsible for the coordination and control of bodily activities and the interpretation of information from the senses (sight, hearing, smell, etc.). - GO:0007420 Brain development
The process whose specific outcome is the progression of the brain over time, from its formation to the mature structure. Brain development begins with patterning events in the neural tube and ends with the mature structure that is the center of thought and emotion. The brain is responsible for the coordination and control of bodily activities and the interpretation of information from the senses (sight, hearing, smell, etc.). - GO:0010468 Regulation of gene expression
Any process that modulates the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA (for protein-coding genes) and the translation of that mRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form. - GO:0021895 Cerebral cortex neuron differentiation
The process in which a relatively unspecialized cell acquires specialized features of a neuron residing in the cerebral cortex. - GO:0021895 Cerebral cortex neuron differentiation
The process in which a relatively unspecialized cell acquires specialized features of a neuron residing in the cerebral cortex. - GO:0040029 Regulation of gene expression, epigenetic
Any process that modulates the frequency, rate or extent of gene expression; the process is mitotically or meiotically heritable, or is stably self-propagated in the cytoplasm of a resting cell, and does not entail a change in DNA sequence. - GO:0040029 Regulation of gene expression, epigenetic
Any process that modulates the frequency, rate or extent of gene expression; the process is mitotically or meiotically heritable, or is stably self-propagated in the cytoplasm of a resting cell, and does not entail a change in DNA sequence. - GO:0048812 Neuron projection morphogenesis
The process in which the anatomical structures of a neuron projection are generated and organized. A neuron projection is any process extending from a neural cell, such as axons or dendrites. - GO:0048854 Brain morphogenesis
The process in which the anatomical structures of the brain are generated and organized. The brain is one of the two components of the central nervous system and is the center of thought and emotion. It is responsible for the coordination and control of bodily activities and the interpretation of information from the senses (sight, hearing, smell, etc.). - GO:0048854 Brain morphogenesis
The process in which the anatomical structures of the brain are generated and organized. The brain is one of the two components of the central nervous system and is the center of thought and emotion. It is responsible for the coordination and control of bodily activities and the interpretation of information from the senses (sight, hearing, smell, etc.). - GO:0050671 Positive regulation of lymphocyte proliferation
Any process that activates or increases the rate or extent of lymphocyte proliferation. - GO:0050671 Positive regulation of lymphocyte proliferation
Any process that activates or increases the rate or extent of lymphocyte proliferation. - GO:0050767 Regulation of neurogenesis
Any process that modulates the frequency, rate or extent of neurogenesis, the origin and formation of neurons. - GO:0050769 Positive regulation of neurogenesis
Any process that activates or increases the frequency, rate or extent of neurogenesis, the origin and formation of neurons. - GO:0051569 Regulation of histone H3-K4 methylation
Any process that modulates the frequency, rate or extent of the covalent addition of a methyl group to the lysine at position 4 of histone H3. - GO:0080182 Histone H3-K4 trimethylation
The modification of histone H3 by addition of three methyl groups to lysine at position 4 of the histone. - GO:0080182 Histone H3-K4 trimethylation
The modification of histone H3 by addition of three methyl groups to lysine at position 4 of the histone.
Protein Sequence
>A2A5K6 MEENEVESSSDAAPRPGQPEEPSESGLGVCTSEAVSADSSDAATVPGLTEADDSGVGQSSDGGNHSVEEVSESISTDPLP HGCLPDSSSVSRGPVAEMPGGPPALVHSSVLPDPSMLVSDCTASSSDLGSAIDKIIESTIGPDLIQSCITVTSGEEGGAE TTQYLILQGPDDGAPMASSMSTSTLANSLAAIEALADGPTSTSACLEPPEEPQGDPSSVAQQPPAPVTEELDLQSLEAMM EVVVVQQFKCKMCQYRSSTKATLLRHMRERHFRPALAAAAAATGKRGRVRKWGTSTKTTEEDRPEEEEEDDDIVDAGAID DLEEDSDYNPAEDEPRGRQLRLQRPTPSTPRPRRRPGRPRKLPRLETSDLHDGVGQPLVSSQSTQSPPELQDLEAPSSSG LRALGKVGRGLVESGVSQSDAENAAPSCQDEADAPPRRRGRPSRRFLGKKYRKYYYKSPKPLLRPYLCRICGSRFLSHED LRFHVNSHEAGDPQLFRCLQCSYRSRRWSSLKEHMFNHVGSKPYKCDECSYTSVYRKDVIRHAAVHSQDRKKRPDPTPKL SSFPCPVCGRVYPMQKRLTQHMKTHSTEKPHMCDKCGKSFKKRYTFKMHLLTHIQAVANRRFKCEFCEFVCEDKKALLNH QLSHVSDKPFKCSFCPYRTFREDFLLSHVAVKHTGAKPFACEYCHFSTRHKKNLRLHVRCRHANSFEEWGRRHPEEPPSR RRPFFSLQQIEELKQQHSTAPGPPLSSPGPEAPQEPAPFQSPETPPLLCPDALGGTTIIYQQGAEESTAVATQTALDLLL NMSAQRELGATALQVAVVKSEGIEAELTSTGGQPSPEDTTPRVVTLHMAESGSSVAAESQLGPSDLQQIALPSGPFGGAS YSVITAPPVEGRTSASGPPYREEPPGEAAQAVVVSDTLKEAGTHYIMAADGTQLHHIELTADGSISFPSPDTLAPGTKWP LLQCGGPPRDGSEVLSPTKTHHMGGSQGSSTPPPAASHTLGLVVPQSPPSAAASSTKKFSCKVCSEAFPSRAEMESHKRA HAGPAAFKCPDCPFSARQWPEVRAHMAQHSSLRPHQCNQCSFASKNKKDLRRHMLTHTNEKPFSCHVCGQRFNRNGHLKF HIQRLHSIDGRKTGTSTARAPAQTIILNSEEETLATLHTAFQSSHGVLGTERLQQALSQEHIIVAQEQTVTNQEEATYIQ EITADGQTVQHLVTSDNQVQYIISQDGVQHLLPQEYVVVPDGHHIQVQEGQITHIQYEQGTPFLQESQIQYVPVSPSQQL VTQAQLEAAAHSAVTAVADAAMAQAQGLFGTEEAVPEQIHQLQHQGIEYDVITLSDD