L3mbtl1 Lethal(3)malignant brain tumor-like protein 1
UniProt Data
Accession | A2A5N8 [ UniProt ] |
Name | LMBL1_MOUSE |
Description | Lethal(3)malignant brain tumor-like protein 1 |
Species | Mus musculus |
Sequence Length | 826 |
Enzyme Annotations (0)
GO Annotations
Cellular component (9)
- GO:0000785 Chromatin
The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome. - GO:0000785 Chromatin
The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome. - GO:0000793 Condensed chromosome
A highly compacted molecule of DNA and associated proteins resulting in a cytologically distinct structure. - GO:0000793 Condensed chromosome
A highly compacted molecule of DNA and associated proteins resulting in a cytologically distinct structure. - GO:0005634 Nucleus
A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent. - GO:0005634 Nucleus
A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent. - GO:0005654 Nucleoplasm
That part of the nuclear content other than the chromosomes or the nucleolus. - GO:0005654 Nucleoplasm
That part of the nuclear content other than the chromosomes or the nucleolus. - GO:0005886 Plasma membrane
The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
Molecular function (11)
- GO:0003682 Chromatin binding
Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase. - GO:0003682 Chromatin binding
Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase. - GO:0031491 Nucleosome binding
Interacting selectively and non-covalently with a nucleosome, a complex comprised of DNA wound around a multisubunit core and associated proteins, which forms the primary packing unit of DNA into higher order structures. - GO:0031491 Nucleosome binding
Interacting selectively and non-covalently with a nucleosome, a complex comprised of DNA wound around a multisubunit core and associated proteins, which forms the primary packing unit of DNA into higher order structures. - GO:0031493 Nucleosomal histone binding
Interacting selectively and non-covalently with a histone that is assembled into a nucleosome. - GO:0031493 Nucleosomal histone binding
Interacting selectively and non-covalently with a histone that is assembled into a nucleosome. - GO:0032093 SAM domain binding
Interacting selectively and non-covalently with a SAM (Sterile Alpha Motif) domain, which is a 70-amino acid protein sequence that participates in protein-protein, protein-lipid, and protein-RNA interactions and is conserved from lower to higher eukaryotes. - GO:0035064 Methylated histone binding
Interacting selectively and non-covalently with a histone protein in which a residue has been modified by methylation. Histones are any of a group of water-soluble proteins found in association with the DNA of plant and animal chromosomes. - GO:0035064 Methylated histone binding
Interacting selectively and non-covalently with a histone protein in which a residue has been modified by methylation. Histones are any of a group of water-soluble proteins found in association with the DNA of plant and animal chromosomes. - GO:0042393 Histone binding
Interacting selectively and non-covalently with a histone, any of a group of water-soluble proteins found in association with the DNA of plant and animal chromosomes. They are involved in the condensation and coiling of chromosomes during cell division and have also been implicated in nonspecific suppression of gene activity. - GO:0042802 Identical protein binding
Interacting selectively and non-covalently with an identical protein or proteins.
Biological process (10)
- GO:0006325 Chromatin organization
Any process that results in the specification, formation or maintenance of the physical structure of eukaryotic chromatin. - GO:0006325 Chromatin organization
Any process that results in the specification, formation or maintenance of the physical structure of eukaryotic chromatin. - GO:0007088 Regulation of mitotic nuclear division
Any process that modulates the frequency, rate or extent of mitosis. - GO:0007088 Regulation of mitotic nuclear division
Any process that modulates the frequency, rate or extent of mitosis. - GO:0030097 Hemopoiesis
The process whose specific outcome is the progression of the myeloid and lymphoid derived organ/tissue systems of the blood and other parts of the body over time, from formation to the mature structure. The site of hemopoiesis is variable during development, but occurs primarily in bone marrow or kidney in many adult vertebrates. - GO:0040029 Regulation of gene expression, epigenetic
Any process that modulates the frequency, rate or extent of gene expression; the process is mitotically or meiotically heritable, or is stably self-propagated in the cytoplasm of a resting cell, and does not entail a change in DNA sequence. - GO:0045652 Regulation of megakaryocyte differentiation
Any process that modulates the frequency, rate or extent of megakaryocyte differentiation. - GO:0045652 Regulation of megakaryocyte differentiation
Any process that modulates the frequency, rate or extent of megakaryocyte differentiation. - GO:0045892 Negative regulation of transcription, DNA-templated
Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription. - GO:0045892 Negative regulation of transcription, DNA-templated
Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
Protein Sequence
>A2A5N8 MEGHTDMEILRTVKGSSTGEVNVHLVARDSAGPHPQLPTTAFIIPTNAATLGLPSTALDVPYPREPVHVGALERVAGSEP VTATILPQLSTGTGTNSTVRLLDWTGVSAPLPGSGMRFRINEYAPLNMIGVERPRSPEQRHEGGMARRDAGIQHPDVHQD RQDITSLEPPVDASSCKCQACGPQQSSGLDVGSSGDRCSQPFQKRSVIVENSGCTIASELLKPMKKRKHKEYQSPSEESE PEAVKQGEGKDAEREPTPSTPENEEWSRSQLVSSEKKDGWSWESYLEEQKAVTAPVSLFQDSQAVTHNKNGFKLGMKLEG IDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQLPKGYKEEEFSWSQYLRSTKAQ AAPKHLFVSQSHSTPPVGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDDWGDTYDYWCDPSSPYIHPVGWCQKQ GKPLTPPQDYPDPDSFCWEKYLEETGTSAVPNWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKLHFDGW SHNYDFWIDADHPDIHPAGWCSKTGHPLEPPLRPRESSSVSPGGCPPLSHRSPPHTKTSKYNFHHRKCPTPGCDGSGHVT GKFTAHHCLSGCPLAEKNQSRLKAELSDSETAARKKNPSNLSPRKKPRHQGRIGRPPKYRKIPEEDLQALPPSVVHQSLF MSTLPTHADRPLSVCWEQHCKLLPGVAGISASTVSKWTIEEVFGFVQTLTGSEDQARLFKDEMIDGEAFLLLTQADIVKI MSVKLGPALKIYNAILMFKNTDDAFK