Sppl2c Signal peptide peptidase-like 2C
UniProt Data
Accession | A2A6C4 [ UniProt ] |
Name | SPP2C_MOUSE |
Description | Signal peptide peptidase-like 2C |
Species | Mus musculus |
Sequence Length | 690 |
Enzyme Annotations (1)
- EC:3.4.23.- Aspartic endopeptidases.
GO Annotations
Cellular component (6)
- GO:0005789 Endoplasmic reticulum membrane
The lipid bilayer surrounding the endoplasmic reticulum. - GO:0005789 Endoplasmic reticulum membrane
The lipid bilayer surrounding the endoplasmic reticulum. - GO:0071458 Integral component of cytoplasmic side of endoplasmic reticulum membrane
The component of the endoplasmic reticulum membrane consisting of the gene products that penetrate only the cytoplasmic side of the membrane. - GO:0071458 Integral component of cytoplasmic side of endoplasmic reticulum membrane
The component of the endoplasmic reticulum membrane consisting of the gene products that penetrate only the cytoplasmic side of the membrane. - GO:0071556 Integral component of lumenal side of endoplasmic reticulum membrane
The component of the endoplasmic reticulum membrane consisting of the gene products that penetrate only the lumenal side of the membrane. - GO:0071556 Integral component of lumenal side of endoplasmic reticulum membrane
The component of the endoplasmic reticulum membrane consisting of the gene products that penetrate only the lumenal side of the membrane.
Molecular function (2)
- GO:0042803 Protein homodimerization activity
Interacting selectively and non-covalently with an identical protein to form a homodimer. - GO:0042803 Protein homodimerization activity
Interacting selectively and non-covalently with an identical protein to form a homodimer.
Biological process (1)
None predictedProtein Sequence
>A2A6C4 MACLGSLHPLGSLLLLFLLLLLSPEARGEYGLVRVVSKNWSKDYCVLYSSDYVNLPRDLHHAPLLSLHDGTKTPWCPDED SFHQAQDSSPRQRPLHQTTTMVTRGNCSFYAKGWLAQDQGAQGLLIVSRARNQQCSDTISKPQDPSKPWPALTIPVAVLR YTDMLDIVSHTYGDTDVRVAMFAPLEPVTDYNMAIIFILAVGTVAAGGYWAGLMEANKLQRRQAQRGGGLGGHNQQQTVA AERSQRAWEDDDFEDAPMDFTPAMTGAVVTMSCSIMILLYFFYDCFVYVMIGIFSLGASTGLYSCLAPILCHLPLWRYQW VLPGQRVSVTWPLLLLAGLCAMVTVLWVIHRNEDHWAWLLQDTLGVAYCLFVLRRVRLPTFKNCTLFLLALLAFDVFFVF ITPLFTKTGESIMVEVASGPADSSSHERLPMVLKVPRLSFSALTLCNQPFSILGFGDIVVPGFLVAYCHRFDMQVQSRQV YYMACTVAYAVGLLVTFVAMILMQMGQPALLYLVSSTLLTSLAVATCRQEFTLFWTGQGRAKIPAEPVAQPCIASAVGSK MKLEDAKDSRTTNRFEQAVDGESGDLESSTGDDMAEMVTLSEDEATSPEGHSESSEGWSDTNLDPNELPSGSPMALEAML IPLIQPIPHPSELGHIRTQSRVHDSSLPWMGLHKRKGLKVKKSMSAQAPL