Genome3D
Escherichia coli K-12

ykfM Uncharacterized protein YkfM

UniProt Data

Accession A5A605 [ UniProt ]
Name YKFM_ECOLI
Description Uncharacterized protein YkfM
Species Escherichia coli K-12
Sequence Length159

Enzyme Annotations (0)

    GO Annotations

    Cellular component (1)

    None predicted

    Molecular function (1)

    None predicted

    Biological process (2)

    • GO:0006974 Cellular response to DNA damage stimulus
      Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    • GO:0046677 Response to antibiotic
      Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an antibiotic stimulus. An antibiotic is a chemical substance produced by a microorganism which has the capacity to inhibit the growth of or to kill other microorganisms.

    Protein Sequence

    >A5A605
MRLHVKLKEFLSMFFMAILFFPAFNASLFFTGVKPLYSIIKCSTEIFYDWRMLILCFGFMSFSFLNIHVILLTIIKSFLI
KKTKVVNFATDITIQLTLIFLLIAIVIAPLIAPFVTGYVNTNYHPCGNNTGIFPGAIYIKNGMKCNNGYISRKEDSAVK