Genome3D
Homo sapiens

TP53I11 Tumor protein p53-inducible protein 11

UniProt Data

Accession O14683 [ UniProt ]
Name P5I11_HUMAN
Description Tumor protein p53-inducible protein 11
Species Homo sapiens
Sequence Length189

Enzyme Annotations (0)

    GO Annotations

    Cellular component (1)

    None predicted

    Molecular function (1)

    None predicted

    Biological process (2)

    • GO:0006950 Response to stress
      Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a disturbance in organismal or cellular homeostasis, usually, but not necessarily, exogenous (e.g. temperature, humidity, ionizing radiation).
    • GO:0008285 Negative regulation of cell proliferation
      Any process that stops, prevents or reduces the rate or extent of cell proliferation.

    Protein Sequence

    >O14683
MAAKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFTIREPLGLRVWQFVSAVLFSGIAIMA
LAFPDQLYDAVFDGAQVTSKTPIRLYGGALLSISLIMWNALYTAEKVIIRWTLLTEACYFGVQFLVVTATLAETGLMSLG
ILLLLVSRLLFVVISIYYYYQVGRRPKKA