Abl Tyrosine-protein kinase Abl
UniProt Data
Accession | P00522 [ UniProt ] |
Name | ABL_DROME |
Description | Tyrosine-protein kinase Abl |
Species | Drosophila melanogaster |
Sequence Length | 1620 |
Enzyme Annotations (2)
- EC:2.7.10.- Protein-tyrosine kinases.
- EC:2.7.10.2 Non-specific protein-tyrosine kinase.
ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.
GO Annotations
Cellular component (10)
- GO:0005737 Cytoplasm
All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. - GO:0005829 Cytosol
The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes. - GO:0005829 Cytosol
The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes. - GO:0005911 Cell-cell junction
A cell junction that forms a connection between two or more cells in a multicellular organism; excludes direct cytoplasmic junctions such as ring canals. - GO:0005912 Adherens junction
A cell junction at which anchoring proteins (cadherins or integrins) extend through the plasma membrane and are attached to actin filaments. - GO:0005927 Muscle tendon junction
A cell-substrate junction found at the terminal anchorage site of skeletal muscle cells to tendons. - GO:0005938 Cell cortex
The region of a cell that lies just beneath the plasma membrane and often, but not always, contains a network of actin filaments and associated proteins. - GO:0019897 Extrinsic component of plasma membrane
The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to one of its surfaces, but not integrated into the hydrophobic region. - GO:0030424 Axon
The long process of a neuron that conducts nerve impulses, usually away from the cell body to the terminals and varicosities, which are sites of storage and release of neurotransmitter. - GO:0045179 Apical cortex
The region that lies just beneath the plasma membrane on the apical edge of a cell.
Molecular function (7)
- GO:0004713 Protein tyrosine kinase activity
Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate. - GO:0004713 Protein tyrosine kinase activity
Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate. - GO:0004713 Protein tyrosine kinase activity
Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate. - GO:0004713 Protein tyrosine kinase activity
Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate. - GO:0004713 Protein tyrosine kinase activity
Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate. - GO:0004715 Non-membrane spanning protein tyrosine kinase activity
Catalysis of the reaction: ATP + protein L-tyrosine = ADP + protein L-tyrosine phosphate by a non-membrane spanning protein. - GO:0005515 Protein binding
Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
Biological process (37)
- GO:0001764 Neuron migration
The characteristic movement of an immature neuron from germinal zones to specific positions where they will reside as they mature. - GO:0002009 Morphogenesis of an epithelium
The process in which the anatomical structures of epithelia are generated and organized. An epithelium consists of closely packed cells arranged in one or more layers, that covers the outer surfaces of the body or lines any internal cavity or tube. - GO:0003382 Epithelial cell morphogenesis
The change in form that occurs when an epithelial cell progresses from its initial formation to its mature state. - GO:0003402 Planar cell polarity pathway involved in axis elongation
The series of molecular signals initiated by binding of a Wnt protein to a receptor on the surface of the target cell where activated receptors signal to modulate cytoskeletal elements and control cell polarity that contributes to axis elongation. - GO:0006468 Protein phosphorylation
The process of introducing a phosphate group on to a protein. - GO:0007268 Chemical synaptic transmission
The vesicular release of classical neurotransmitter molecules from a neuron, across a chemical synapse, the subsequent activation of neurotransmitter receptors of a target cell (neuron, muscle, or secretory cell) and the effects of this activation on the postsynaptic membrane potential and ionic composition of the postsynaptic cytosol. This process encompasses both spontaneous and evoked release of neurotransmitter and all parts of synaptic vesicle exocytosis. Evoked transmission starts with the arrival of an action potential at the presynapse. - GO:0007303 Cytoplasmic transport, nurse cell to oocyte
The directed movement of cytoplasmic constituents synthesized in the nurse cells to the oocyte. - GO:0007370 Ventral furrow formation
Formation of a ventral indentation (furrow) from the blastoderm epithelium, which is internalized to form a tube in the interior of the embryo, marking the start of gastrulation. - GO:0007391 Dorsal closure
The process during Drosophila embryogenesis whereby the ectodermal cells of the lateral epithelium stretch in a coordinated fashion to internalize the amnioserosa cells and close the embryo dorsally. - GO:0007391 Dorsal closure
The process during Drosophila embryogenesis whereby the ectodermal cells of the lateral epithelium stretch in a coordinated fashion to internalize the amnioserosa cells and close the embryo dorsally. - GO:0007409 Axonogenesis
De novo generation of a long process of a neuron, that carries efferent (outgoing) action potentials from the cell body towards target cells. Refers to the morphogenesis or creation of shape or form of the developing axon. - GO:0007411 Axon guidance
The chemotaxis process that directs the migration of an axon growth cone to a specific target site in response to a combination of attractive and repulsive cues. - GO:0007411 Axon guidance
The chemotaxis process that directs the migration of an axon growth cone to a specific target site in response to a combination of attractive and repulsive cues. - GO:0007417 Central nervous system development
The process whose specific outcome is the progression of the central nervous system over time, from its formation to the mature structure. The central nervous system is the core nervous system that serves an integrating and coordinating function. In vertebrates it consists of the brain and spinal cord. In those invertebrates with a central nervous system it typically consists of a brain, cerebral ganglia and a nerve cord. - GO:0007419 Ventral cord development
The process whose specific outcome is the progression of the ventral cord over time, from its formation to the mature structure. The ventral cord is one of the distinguishing traits of the central nervous system of all arthropods (such as insects, crustaceans and arachnids) as well as many other invertebrates, such as the annelid worms. - GO:0007419 Ventral cord development
The process whose specific outcome is the progression of the ventral cord over time, from its formation to the mature structure. The ventral cord is one of the distinguishing traits of the central nervous system of all arthropods (such as insects, crustaceans and arachnids) as well as many other invertebrates, such as the annelid worms. - GO:0007611 Learning or memory
The acquisition and processing of information and/or the storage and retrieval of this information over time. - GO:0008045 Motor neuron axon guidance
The process in which the migration of an axon growth cone of a motor neuron is directed to a specific target site in response to a combination of attractive and repulsive cues. - GO:0008064 Regulation of actin polymerization or depolymerization
Any process that modulates the frequency, rate or extent of the assembly or disassembly of actin filaments by the addition or removal of actin monomers from a filament. - GO:0008360 Regulation of cell shape
Any process that modulates the surface configuration of a cell. - GO:0008360 Regulation of cell shape
Any process that modulates the surface configuration of a cell. - GO:0010592 Positive regulation of lamellipodium assembly
Any process that increases the rate, frequency or extent of the formation of a lamellipodium, a thin sheetlike extension of the surface of a migrating cell. - GO:0010906 Regulation of glucose metabolic process
Any process that modulates the rate, frequency or extent of glucose metabolism. Glucose metabolic processes are the chemical reactions and pathways involving glucose, the aldohexose gluco-hexose. - GO:0010977 Negative regulation of neuron projection development
Any process that decreases the rate, frequency or extent of neuron projection development. Neuron projection development is the process whose specific outcome is the progression of a neuron projection over time, from its formation to the mature structure. A neuron projection is any process extending from a neural cell, such as axons or dendrites (collectively called neurites). - GO:0016199 Axon midline choice point recognition
The recognition of molecules at the central nervous system midline choice point by an axon growth cone; this choice point determines whether the growth cone will cross the midline. - GO:0018108 Peptidyl-tyrosine phosphorylation
The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine. - GO:0018108 Peptidyl-tyrosine phosphorylation
The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine. - GO:0021785 Branchiomotor neuron axon guidance
The process in which a branchiomotor neuron growth cone is directed to a specific target site. Branchiomotor neurons are located in the hindbrain and innervate branchial arch-derived muscles that control jaw movements, facial expression, the larynx, and the pharynx. - GO:0031647 Regulation of protein stability
Any process that affects the structure and integrity of a protein, altering the likelihood of its degradation or aggregation. - GO:0032880 Regulation of protein localization
Any process that modulates the frequency, rate or extent of any process in which a protein is transported to, or maintained in, a specific location. - GO:0045886 Negative regulation of synaptic growth at neuromuscular junction
Any process that stops, prevents, or reduces the frequency, rate or extent of synaptic growth at neuromuscular junction. - GO:0046777 Protein autophosphorylation
The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation). - GO:0046827 Positive regulation of protein export from nucleus
Any process that activates or increases the frequency, rate or extent of directed movement of proteins from the nucleus into the cytoplasm. - GO:0048749 Compound eye development
The process whose specific outcome is the progression of the compound eye over time, from its formation to the mature structure. The compound eye is an organ of sight that contains multiple repeating units, often arranged hexagonally. Each unit has its own lens and photoreceptor cell(s) and can generate either a single pixelated image or multiple images, per eye. - GO:0048813 Dendrite morphogenesis
The process in which the anatomical structures of a dendrite are generated and organized. A dendrite is a freely branching protoplasmic process of a nerve cell. - GO:0072499 Photoreceptor cell axon guidance
The chemotaxis process that directs the migration of a photoreceptor cell axon growth cone to its target in the optic lobe in response to a combination of attractive and repulsive cues. - GO:0072499 Photoreceptor cell axon guidance
The chemotaxis process that directs the migration of a photoreceptor cell axon growth cone to its target in the optic lobe in response to a combination of attractive and repulsive cues.
Protein Sequence
>P00522 MGAQQGKDRGAHSGGGGSGAPVSCIGLSSSPVASVSPHCISSSSGVSSAPLGGGSTLRGSRIKSSSSGVASGSGSGGGGG GSGSGLSQRSGGHKDARCNPTVGLNIFTEHNEALLQSRPLPHIPAGSTAASLLADAAELQQHQQDSGGLGLQGSSLGGGH SSTTSVFESAHRWTSKENLLAPGPEEDDPQLFVALYDFQAGGENQLSLKKGEQVRILSYNKSGEWCEAHSDSGNVGWVPS NYVTPLNSLEKHSWYHGPISRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRISEDPDGKVFVTQEAKFN TLAELVHHHSVPHEGHGLITPLLYPAPKQNKPTVFPLSPEPDEWEICRTDIMMKHKLGGGQYGEVYEAVWKRYGNTVAVK TLKEDTMALKDFLEEAAIMKEMKHPNLVQLIGVCTREPPFYIITEFMSHGNLLDFLRSAGRETLDAVALLYMATQIASGM SYLESRNYIHRDLAARNCLVGDNKLVKVADFGLARLMRDDTYTAHAGAKFPIKWTAPEGLAYNKFSTKSDVWAFGVLLWE IATYGMSPYPAIDLTDVYHKLDKGYRMERPPGCPPEVYDLMRQCWQWDATDRPTFKSIHHALEHMFQESSITEAVEKQLN ANATSASSSAPSTSGVATGGGATTTTAASGCASSSSATASLSLTPQMVKKGLPGGQALTPNAHHNDPHQQQASTPMSETG STSTKLSTFSSQGKGNVQMRRTTNKQGKQAPAPPKRTSLLSSSRDSTYREEDPANARCNFIDDLSTNGLARDINSLTQRY DSETDPAADPDTDATGDSLEQSLSQVIAAPVTNKMQHSLHSGGGGGGIGPRSSQQHSSFKRPTGTPVMGNRGLETRQSKR SQLHSQAPGPGPPSTQPHHGNNGVVTSAHPITVGALDVMNVKQVVNRYGTLPKGARIGAYLDSLEDSSEAAPALPATAPS LPPANGHATPPAARLNPKASPIPPQQMIRSNSSGGVTMQNNAAASLNKLQRHRTTTEGTMMTFSSFRAGGSSSSPKRSAS GVASGVQPALANLEFPPPPLDLPPPPEEFEGGPPPPPPAPESAVQAIQQHLHAQLPNNGNISNGNGTNNNDSSHNDVSNI APSVEEASSRFGVSLRKREPSTDSCSSLGSPPEDLKEKLITEIKAAGKDTAPASHLANGSGIAVVDPVSLLVTELAESMN LPKPPPQQQQKLTNGNSTGSGFKAQLKKVEPKKMSAPMPKAEPANTIIDFKAHLRRVDKEKEPATPAPAPATVAVANNAN CNTTGTLNRKEDGSKKFSQAMQKTEIKIDVTNSNVEADAGAAGEGDLGKRRSTGSINSLKKLWEQQPPAPDYATSTILQQ QPSVVNGGGTPNAQLSPKYGMKSGAINTVGTLPAKLGNKQPPAAPPPPPPNCTTSNSSTTSISTSSRDCTSRQQASSTIK TSHSTQLFTDDEEQSHTEGLGSGGQGSADMTQSLYEQKPQIQQKPAVPHKPTKLTIYATPIAKLTEPASSASSTQISRES ILELVGLLEGSLKHPVNAIAGSQWLQLSDKLNILHNSCVIFAENGAMPPHSKFQFRELVTRVEAQSQHLRSAGSKNVQDN ERLVAEVGQSLRQISNALNR