Tp53 Cellular tumor antigen p53

• Overview
• Annotations

UniProt Data

Enzyme Annotations (0)

GO Annotations

Cellular component (22)

• GO:0000790 Nuclear chromatin
  The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome in the nucleus.
• GO:0005622 Intracellular
  The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
• GO:0005634 Nucleus
  A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
• GO:0005634 Nucleus
  A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
• GO:0005634 Nucleus
  A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
• GO:0005654 Nucleoplasm
  That part of the nuclear content other than the chromosomes or the nucleolus.
• GO:0005657 Replication fork
  The Y-shaped region of a replicating DNA molecule, resulting from the separation of the DNA strands and in which the synthesis of new strands takes place. Also includes associated protein complexes.
• GO:0005730 Nucleolus
  A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
• GO:0005730 Nucleolus
  A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
• GO:0005737 Cytoplasm
  All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
• GO:0005737 Cytoplasm
  All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
• GO:0005737 Cytoplasm
  All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
• GO:0005739 Mitochondrion
  A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
• GO:0005739 Mitochondrion
  A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
• GO:0005739 Mitochondrion
  A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
• GO:0005759 Mitochondrial matrix
  The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
• GO:0016363 Nuclear matrix
  The dense fibrillar network lying on the inner side of the nuclear membrane.
• GO:0016605 PML body
  A class of nuclear body; they react against SP100 auto-antibodies (PML, promyelocytic leukemia); cells typically contain 10-30 PML bodies per nucleus; alterations in the localization of PML bodies occurs after viral infection.
• GO:0035861 Site of double-strand break
  A region of a chromosome at which a DNA double-strand break has occurred. DNA damage signaling and repair proteins accumulate at the lesion to respond to the damage and repair the DNA to form a continuous DNA helix.
• GO:0043234 Protein complex
  A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Molecular function (44)

• GO:0000977 RNA polymerase II regulatory region sequence-specific DNA binding
  Interacting selectively and non-covalently with a specific sequence of DNA that is part of a regulatory region that controls the transcription of a gene or cistron by RNA polymerase II.
• GO:0000977 RNA polymerase II regulatory region sequence-specific DNA binding
  Interacting selectively and non-covalently with a specific sequence of DNA that is part of a regulatory region that controls the transcription of a gene or cistron by RNA polymerase II.
• GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
  Interacting selectively and non-covalently with the regulatory region composed of the transcription start site and binding sites for transcription factors of the RNA polymerase II basal transcription machinery.
• GO:0000981 RNA polymerase II transcription factor activity, sequence-specific DNA binding
  Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription by RNA polymerase II. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
• GO:0000990 Transcription factor activity, core RNA polymerase binding
  Interacting selectively and non-covalently with an RNA polymerase in order to modulate transcription. A protein binding transcription factor may or may not also interact with the template nucleic acid (either DNA or RNA) as well.
• GO:0001046 Core promoter sequence-specific DNA binding
  Interacting selectively and non-covalently with a sequence of DNA that is part of a core promoter region composed of the transcription start site and binding sites for the basal transcription machinery. The transcribed region might be described as a gene, cistron, or operon.
• GO:0001046 Core promoter sequence-specific DNA binding
  Interacting selectively and non-covalently with a sequence of DNA that is part of a core promoter region composed of the transcription start site and binding sites for the basal transcription machinery. The transcribed region might be described as a gene, cistron, or operon.
• GO:0001077 Transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding
  Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II (RNAP II) in order to activate or increase the frequency, rate or extent of transcription from the RNAP II promoter.
• GO:0001077 Transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding
  Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II (RNAP II) in order to activate or increase the frequency, rate or extent of transcription from the RNAP II promoter.
• GO:0001085 RNA polymerase II transcription factor binding
  Interacting selectively and non-covalently with an RNA polymerase II transcription factor, any protein required to initiate or regulate transcription by RNA polymerase II.
• GO:0001228 Transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
  Interacting selectively and non-covalently with a sequence of DNA that is in the transcription regulatory region for RNA polymerase II (RNAP II) in order to activate or increase the frequency, rate or extent of transcription from the RNAP II promoter.
• GO:0002020 Protease binding
  Interacting selectively and non-covalently with any protease or peptidase.
• GO:0002039 P53 binding
  Interacting selectively and non-covalently with one of the p53 family of proteins.
• GO:0003677 DNA binding
  Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
• GO:0003677 DNA binding
  Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
• GO:0003677 DNA binding
  Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
• GO:0003682 Chromatin binding
  Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
• GO:0003682 Chromatin binding
  Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
• GO:0003700 Transcription factor activity, sequence-specific DNA binding
  Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
• GO:0003700 Transcription factor activity, sequence-specific DNA binding
  Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
• GO:0003730 MRNA 3'-UTR binding
  Interacting selectively and non-covalently with the 3' untranslated region of an mRNA molecule.
• GO:0005507 Copper ion binding
  Interacting selectively and non-covalently with copper (Cu) ions.
• GO:0005507 Copper ion binding
  Interacting selectively and non-covalently with copper (Cu) ions.
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
• GO:0005524 ATP binding
  Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
• GO:0005524 ATP binding
  Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
• GO:0008134 Transcription factor binding
  Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
• GO:0019899 Enzyme binding
  Interacting selectively and non-covalently with any enzyme.
• GO:0019901 Protein kinase binding
  Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
• GO:0019903 Protein phosphatase binding
  Interacting selectively and non-covalently with any protein phosphatase.
• GO:0030971 Receptor tyrosine kinase binding
  Interacting selectively and non-covalently with a receptor that possesses protein tyrosine kinase activity.
• GO:0031625 Ubiquitin protein ligase binding
  Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
• GO:0035033 Histone deacetylase regulator activity
  Modulates the activity of histone deacetylase.
• GO:0035035 Histone acetyltransferase binding
  Interacting selectively and non-covalently with the enzyme histone acetyltransferase.
• GO:0042802 Identical protein binding
  Interacting selectively and non-covalently with an identical protein or proteins.
• GO:0042826 Histone deacetylase binding
  Interacting selectively and non-covalently with the enzyme histone deacetylase.
• GO:0043621 Protein self-association
  Interacting selectively and non-covalently with a domain within the same polypeptide.
• GO:0044212 Transcription regulatory region DNA binding
  Interacting selectively and non-covalently with a DNA region that regulates the transcription of a region of DNA, which may be a gene, cistron, or operon. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
• GO:0046982 Protein heterodimerization activity
  Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
• GO:0047485 Protein N-terminus binding
  Interacting selectively and non-covalently with a protein N-terminus, the end of any peptide chain at which the 2-amino (or 2-imino) function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
• GO:0051087 Chaperone binding
  Interacting selectively and non-covalently with a chaperone protein, a class of proteins that bind to nascent or unfolded polypeptides and ensure correct folding or transport.
• GO:0051721 Protein phosphatase 2A binding
  Interacting selectively and non-covalently with the enzyme protein phosphatase 2A.
• GO:0097371 MDM2/MDM4 family protein binding
  Interacting selectively and non-covalently with any isoform of the MDM2/MDM4 protein family, comprising negative regulators of p53.
• GO:0097718 Disordered domain specific binding
  Interacting selectively and non-covalently with a disordered domain of a protein.

Biological process (174)

• GO:0000060 Protein import into nucleus, translocation
  A protein transport process that contributes to protein import into the nucleus, and that results in the vectorial transfer of a cargo-carrier protein complex through the nuclear pore complex from the cytoplasmic side to the nucleoplasmic side of the nuclear envelope.
• GO:0000122 Negative regulation of transcription from RNA polymerase II promoter
  Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
• GO:0000122 Negative regulation of transcription from RNA polymerase II promoter
  Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
• GO:0000122 Negative regulation of transcription from RNA polymerase II promoter
  Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
• GO:0000122 Negative regulation of transcription from RNA polymerase II promoter
  Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
• GO:0000733 DNA strand renaturation
  The identification and annealing of complementary base pairs in single-strand DNA.
• GO:0000733 DNA strand renaturation
  The identification and annealing of complementary base pairs in single-strand DNA.
• GO:0001701 In utero embryonic development
  The process whose specific outcome is the progression of the embryo in the uterus over time, from formation of the zygote in the oviduct, to birth. An example of this process is found in Mus musculus.
• GO:0001756 Somitogenesis
  The formation of mesodermal clusters that are arranged segmentally along the anterior posterior axis of an embryo.
• GO:0001836 Release of cytochrome c from mitochondria
  The process that results in the movement of cytochrome c from the mitochondrial intermembrane space into the cytosol, which is part of the apoptotic signaling pathway and leads to caspase activation.
• GO:0001836 Release of cytochrome c from mitochondria
  The process that results in the movement of cytochrome c from the mitochondrial intermembrane space into the cytosol, which is part of the apoptotic signaling pathway and leads to caspase activation.
• GO:0002309 T cell proliferation involved in immune response
  The expansion of a T cell population by cell division as part of an immune response.
• GO:0002326 B cell lineage commitment
  The process in which a lymphoid progenitor cell becomes committed to become any type of B cell.
• GO:0002360 T cell lineage commitment
  The process in which a lymphoid progenitor cell becomes committed to becoming any type of T cell.
• GO:0002931 Response to ischemia
  Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a inadequate blood supply.
• GO:0006289 Nucleotide-excision repair
  A DNA repair process in which a small region of the strand surrounding the damage is removed from the DNA helix as an oligonucleotide. The small gap left in the DNA helix is filled in by the sequential action of DNA polymerase and DNA ligase. Nucleotide excision repair recognizes a wide range of substrates, including damage caused by UV irradiation (pyrimidine dimers and 6-4 photoproducts) and chemicals (intrastrand cross-links and bulky adducts).
• GO:0006289 Nucleotide-excision repair
  A DNA repair process in which a small region of the strand surrounding the damage is removed from the DNA helix as an oligonucleotide. The small gap left in the DNA helix is filled in by the sequential action of DNA polymerase and DNA ligase. Nucleotide excision repair recognizes a wide range of substrates, including damage caused by UV irradiation (pyrimidine dimers and 6-4 photoproducts) and chemicals (intrastrand cross-links and bulky adducts).
• GO:0006302 Double-strand break repair
  The repair of double-strand breaks in DNA via homologous and nonhomologous mechanisms to reform a continuous DNA helix.
• GO:0006355 Regulation of transcription, DNA-templated
  Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
• GO:0006355 Regulation of transcription, DNA-templated
  Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
• GO:0006357 Regulation of transcription from RNA polymerase II promoter
  Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter.
• GO:0006461 Protein complex assembly
  The aggregation, arrangement and bonding together of a set of components to form a protein complex.
• GO:0006914 Autophagy
  The process in which cells digest parts of their own cytoplasm; allows for both recycling of macromolecular constituents under conditions of cellular stress and remodeling the intracellular structure for cell differentiation.
• GO:0006915 Apoptotic process
  A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
• GO:0006915 Apoptotic process
  A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
• GO:0006974 Cellular response to DNA damage stimulus
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
• GO:0006974 Cellular response to DNA damage stimulus
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
• GO:0006974 Cellular response to DNA damage stimulus
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
• GO:0006977 DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
  A cascade of processes induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage and resulting in the stopping or reduction in rate of the cell cycle.
• GO:0006977 DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
  A cascade of processes induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage and resulting in the stopping or reduction in rate of the cell cycle.
• GO:0006978 DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator
  A cascade of processes induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, resulting in the induction of the transcription of p21 (also known as WAF1, CIP1 and SDI1) or any equivalent protein, in response to the detection of DNA damage.
• GO:0006978 DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator
  A cascade of processes induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, resulting in the induction of the transcription of p21 (also known as WAF1, CIP1 and SDI1) or any equivalent protein, in response to the detection of DNA damage.
• GO:0006979 Response to oxidative stress
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
• GO:0006979 Response to oxidative stress
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
• GO:0006983 ER overload response
  The series of molecular signals generated by the accumulation of normal or misfolded proteins in the endoplasmic reticulum and leading to activation of transcription by NF-kappaB.
• GO:0007050 Cell cycle arrest
  A regulatory process that halts progression through the cell cycle during one of the normal phases (G1, S, G2, M).
• GO:0007179 Transforming growth factor beta receptor signaling pathway
  A series of molecular signals initiated by the binding of an extracellular ligand to a transforming growth factor beta receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0007275 Multicellular organism development
  The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
• GO:0007275 Multicellular organism development
  The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
• GO:0007369 Gastrulation
  A complex and coordinated series of cellular movements that occurs at the end of cleavage during embryonic development of most animals. The details of gastrulation vary from species to species, but usually result in the formation of the three primary germ layers, ectoderm, mesoderm and endoderm.
• GO:0007406 Negative regulation of neuroblast proliferation
  Any process that stops, prevents, or reduces the frequency, rate or extent of the proliferation of neuroblasts.
• GO:0007417 Central nervous system development
  The process whose specific outcome is the progression of the central nervous system over time, from its formation to the mature structure. The central nervous system is the core nervous system that serves an integrating and coordinating function. In vertebrates it consists of the brain and spinal cord. In those invertebrates with a central nervous system it typically consists of a brain, cerebral ganglia and a nerve cord.
• GO:0007507 Heart development
  The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
• GO:0007569 Cell aging
  An aging process that has as participant a cell after a cell has stopped dividing. Cell aging may occur when a cell has temporarily stopped dividing through cell cycle arrest (GO:0007050) or when a cell has permanently stopped dividing, in which case it is undergoing cellular senescence (GO:0090398). May precede cell death (GO:0008219) and succeed cell maturation (GO:0048469).
• GO:0007569 Cell aging
  An aging process that has as participant a cell after a cell has stopped dividing. Cell aging may occur when a cell has temporarily stopped dividing through cell cycle arrest (GO:0007050) or when a cell has permanently stopped dividing, in which case it is undergoing cellular senescence (GO:0090398). May precede cell death (GO:0008219) and succeed cell maturation (GO:0048469).
• GO:0007569 Cell aging
  An aging process that has as participant a cell after a cell has stopped dividing. Cell aging may occur when a cell has temporarily stopped dividing through cell cycle arrest (GO:0007050) or when a cell has permanently stopped dividing, in which case it is undergoing cellular senescence (GO:0090398). May precede cell death (GO:0008219) and succeed cell maturation (GO:0048469).
• GO:0007623 Circadian rhythm
  Any biological process in an organism that recurs with a regularity of approximately 24 hours.
• GO:0008104 Protein localization
  Any process in which a protein is transported to, or maintained in, a specific location.
• GO:0008156 Negative regulation of DNA replication
  Any process that stops, prevents, or reduces the frequency, rate or extent of DNA replication.
• GO:0008156 Negative regulation of DNA replication
  Any process that stops, prevents, or reduces the frequency, rate or extent of DNA replication.
• GO:0008285 Negative regulation of cell proliferation
  Any process that stops, prevents or reduces the rate or extent of cell proliferation.
• GO:0008285 Negative regulation of cell proliferation
  Any process that stops, prevents or reduces the rate or extent of cell proliferation.
• GO:0008285 Negative regulation of cell proliferation
  Any process that stops, prevents or reduces the rate or extent of cell proliferation.
• GO:0008340 Determination of adult lifespan
  The control of viability and duration in the adult phase of the life-cycle.
• GO:0009303 RRNA transcription
  The synthesis of ribosomal RNA (rRNA), any RNA that forms part of the ribosomal structure, from a DNA template.
• GO:0009411 Response to UV
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ultraviolet radiation (UV light) stimulus. Ultraviolet radiation is electromagnetic radiation with a wavelength in the range of 10 to 380 nanometers.
• GO:0009411 Response to UV
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ultraviolet radiation (UV light) stimulus. Ultraviolet radiation is electromagnetic radiation with a wavelength in the range of 10 to 380 nanometers.
• GO:0009651 Response to salt stress
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating an increase or decrease in the concentration of salt (particularly but not exclusively sodium and chloride ions) in the environment.
• GO:0009792 Embryo development ending in birth or egg hatching
  The process whose specific outcome is the progression of an embryo over time, from zygote formation until the end of the embryonic life stage. The end of the embryonic life stage is organism-specific and may be somewhat arbitrary; for mammals it is usually considered to be birth, for insects the hatching of the first instar larva from the eggshell.
• GO:0010165 Response to X-ray
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of X-ray radiation. An X-ray is a form of electromagnetic radiation with a wavelength in the range of 10 nanometers to 100 picometers (corresponding to frequencies in the range 30 PHz to 3 EHz).
• GO:0010165 Response to X-ray
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of X-ray radiation. An X-ray is a form of electromagnetic radiation with a wavelength in the range of 10 nanometers to 100 picometers (corresponding to frequencies in the range 30 PHz to 3 EHz).
• GO:0010332 Response to gamma radiation
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a gamma radiation stimulus. Gamma radiation is a form of electromagnetic radiation (EMR) or light emission of a specific frequency produced from sub-atomic particle interaction, such as electron-positron annihilation and radioactive decay. Gamma rays are generally characterized as EMR having the highest frequency and energy, and also the shortest wavelength, within the electromagnetic radiation spectrum.
• GO:0010332 Response to gamma radiation
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a gamma radiation stimulus. Gamma radiation is a form of electromagnetic radiation (EMR) or light emission of a specific frequency produced from sub-atomic particle interaction, such as electron-positron annihilation and radioactive decay. Gamma rays are generally characterized as EMR having the highest frequency and energy, and also the shortest wavelength, within the electromagnetic radiation spectrum.
• GO:0010332 Response to gamma radiation
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a gamma radiation stimulus. Gamma radiation is a form of electromagnetic radiation (EMR) or light emission of a specific frequency produced from sub-atomic particle interaction, such as electron-positron annihilation and radioactive decay. Gamma rays are generally characterized as EMR having the highest frequency and energy, and also the shortest wavelength, within the electromagnetic radiation spectrum.
• GO:0010628 Positive regulation of gene expression
  Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA (for protein-coding genes) and the translation of that mRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
• GO:0010629 Negative regulation of gene expression
  Any process that decreases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA (for protein-coding genes) and the translation of that mRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
• GO:0010666 Positive regulation of cardiac muscle cell apoptotic process
  Any process that increases the rate or extent of cardiac cell apoptotic process, a form of programmed cell death induced by external or internal signals that trigger the activity of proteolytic caspases whose actions dismantle a cardiac muscle cell and result in its death.
• GO:0016032 Viral process
  A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
• GO:0021549 Cerebellum development
  The process whose specific outcome is the progression of the cerebellum over time, from its formation to the mature structure. The cerebellum is the portion of the brain in the back of the head between the cerebrum and the pons. In mice, the cerebellum controls balance for walking and standing, modulates the force and range of movement and is involved in the learning of motor skills.
• GO:0030308 Negative regulation of cell growth
  Any process that stops, prevents, or reduces the frequency, rate, extent or direction of cell growth.
• GO:0030308 Negative regulation of cell growth
  Any process that stops, prevents, or reduces the frequency, rate, extent or direction of cell growth.
• GO:0030330 DNA damage response, signal transduction by p53 class mediator
  A cascade of processes induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage.
• GO:0030330 DNA damage response, signal transduction by p53 class mediator
  A cascade of processes induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage.
• GO:0030330 DNA damage response, signal transduction by p53 class mediator
  A cascade of processes induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage.
• GO:0030512 Negative regulation of transforming growth factor beta receptor signaling pathway
  Any process that stops, prevents, or reduces the frequency, rate or extent of any TGF-beta receptor signaling pathway.
• GO:0031065 Positive regulation of histone deacetylation
  Any process that activates or increases the frequency, rate or extent of the removal of acetyl groups from histones.
• GO:0031497 Chromatin assembly
  The assembly of DNA, histone proteins, other associated proteins, and sometimes RNA, into chromatin structure, beginning with the formation of the basic unit, the nucleosome, followed by organization of the nucleosomes into higher order structures, ultimately giving rise to a complex organization of specific domains within the nucleus.
• GO:0031571 Mitotic G1 DNA damage checkpoint
  A mitotic cell cycle checkpoint that detects and negatively regulates progression through the G1/S transition of the cell cycle in response to DNA damage.
• GO:0031571 Mitotic G1 DNA damage checkpoint
  A mitotic cell cycle checkpoint that detects and negatively regulates progression through the G1/S transition of the cell cycle in response to DNA damage.
• GO:0032461 Positive regulation of protein oligomerization
  Any process that activates or increases the frequency, rate or extent of protein oligomerization.
• GO:0033077 T cell differentiation in thymus
  The process in which a precursor cell type acquires the specialized features of a T cell via a differentiation pathway dependent upon transit through the thymus.
• GO:0034103 Regulation of tissue remodeling
  Any process that modulates the frequency, rate, or extent of tissue remodeling.
• GO:0034613 Cellular protein localization
  Any process in which a protein is transported to, and/or maintained in, a specific location at the level of a cell. Localization at the cellular level encompasses movement within the cell, from within the cell to the cell surface, or from one location to another at the surface of a cell.
• GO:0034644 Cellular response to UV
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ultraviolet radiation (UV light) stimulus. Ultraviolet radiation is electromagnetic radiation with a wavelength in the range of 10 to 380 nanometers.
• GO:0034644 Cellular response to UV
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ultraviolet radiation (UV light) stimulus. Ultraviolet radiation is electromagnetic radiation with a wavelength in the range of 10 to 380 nanometers.
• GO:0034644 Cellular response to UV
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ultraviolet radiation (UV light) stimulus. Ultraviolet radiation is electromagnetic radiation with a wavelength in the range of 10 to 380 nanometers.
• GO:0035264 Multicellular organism growth
  The increase in size or mass of an entire multicellular organism, as opposed to cell growth.
• GO:0035794 Positive regulation of mitochondrial membrane permeability
  Any process that increases the frequency, rate or extent of the passage or uptake of molecules by the mitochondrial membrane.
• GO:0036003 Positive regulation of transcription from RNA polymerase II promoter in response to stress
  Any process that increases the frequency, rate or extent of transcription from an RNA polymerase II promoter as a result of a stimulus indicating the organism is under stress. The stress is usually, but not necessarily, exogenous (e.g. temperature, humidity, ionizing radiation).
• GO:0042127 Regulation of cell proliferation
  Any process that modulates the frequency, rate or extent of cell proliferation.
• GO:0042127 Regulation of cell proliferation
  Any process that modulates the frequency, rate or extent of cell proliferation.
• GO:0042149 Cellular response to glucose starvation
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of deprivation of glucose.
• GO:0042493 Response to drug
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
• GO:0042771 Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
  A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage, and ends when the execution phase of apoptosis is triggered.
• GO:0042771 Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
  A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage, and ends when the execution phase of apoptosis is triggered.
• GO:0042771 Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
  A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage, and ends when the execution phase of apoptosis is triggered.
• GO:0042771 Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
  A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage, and ends when the execution phase of apoptosis is triggered.
• GO:0042981 Regulation of apoptotic process
  Any process that modulates the occurrence or rate of cell death by apoptotic process.
• GO:0043065 Positive regulation of apoptotic process
  Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
• GO:0043065 Positive regulation of apoptotic process
  Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
• GO:0043065 Positive regulation of apoptotic process
  Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
• GO:0043066 Negative regulation of apoptotic process
  Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
• GO:0043066 Negative regulation of apoptotic process
  Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
• GO:0043153 Entrainment of circadian clock by photoperiod
  The synchronization of a circadian rhythm to photoperiod, the intermittent cycle of light (day) and dark (night).
• GO:0043504 Mitochondrial DNA repair
  The process of restoring mitochondrial DNA after damage.
• GO:0043523 Regulation of neuron apoptotic process
  Any process that modulates the occurrence or rate of cell death by apoptotic process in neurons.
• GO:0043525 Positive regulation of neuron apoptotic process
  Any process that activates or increases the frequency, rate or extent of cell death of neurons by apoptotic process.
• GO:0043525 Positive regulation of neuron apoptotic process
  Any process that activates or increases the frequency, rate or extent of cell death of neurons by apoptotic process.
• GO:0043525 Positive regulation of neuron apoptotic process
  Any process that activates or increases the frequency, rate or extent of cell death of neurons by apoptotic process.
• GO:0045861 Negative regulation of proteolysis
  Any process that stops, prevents, or reduces the frequency, rate or extent of the hydrolysis of a peptide bond or bonds within a protein.
• GO:0045892 Negative regulation of transcription, DNA-templated
  Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
• GO:0045892 Negative regulation of transcription, DNA-templated
  Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
• GO:0045892 Negative regulation of transcription, DNA-templated
  Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
• GO:0045893 Positive regulation of transcription, DNA-templated
  Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
• GO:0045893 Positive regulation of transcription, DNA-templated
  Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
• GO:0045893 Positive regulation of transcription, DNA-templated
  Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
• GO:0045930 Negative regulation of mitotic cell cycle
  Any process that stops, prevents or reduces the rate or extent of progression through the mitotic cell cycle.
• GO:0045944 Positive regulation of transcription from RNA polymerase II promoter
  Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
• GO:0045944 Positive regulation of transcription from RNA polymerase II promoter
  Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
• GO:0045944 Positive regulation of transcription from RNA polymerase II promoter
  Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
• GO:0045944 Positive regulation of transcription from RNA polymerase II promoter
  Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
• GO:0048147 Negative regulation of fibroblast proliferation
  Any process that stops, prevents, or reduces the frequency, rate or extent of multiplication or reproduction of fibroblast cells.
• GO:0048147 Negative regulation of fibroblast proliferation
  Any process that stops, prevents, or reduces the frequency, rate or extent of multiplication or reproduction of fibroblast cells.
• GO:0048512 Circadian behavior
  The specific behavior of an organism that recurs with a regularity of approximately 24 hours.
• GO:0048568 Embryonic organ development
  Development, taking place during the embryonic phase, of a tissue or tissues that work together to perform a specific function or functions. Development pertains to the process whose specific outcome is the progression of a structure over time, from its formation to the mature structure. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that work together to perform a specific function or functions.
• GO:0050731 Positive regulation of peptidyl-tyrosine phosphorylation
  Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
• GO:0050821 Protein stabilization
  Any process involved in maintaining the structure and integrity of a protein and preventing it from degradation or aggregation.
• GO:0051276 Chromosome organization
  A process that is carried out at the cellular level that results in the assembly, arrangement of constituent parts, or disassembly of chromosomes, structures composed of a very long molecule of DNA and associated proteins that carries hereditary information. This term covers covalent modifications at the molecular level as well as spatial relationships among the major components of a chromosome.
• GO:0051289 Protein homotetramerization
  The formation of a protein homotetramer, a macromolecular structure consisting of four noncovalently associated identical subunits.
• GO:0051402 Neuron apoptotic process
  Any apoptotic process in a neuron, the basic cellular unit of nervous tissue. Each neuron consists of a body, an axon, and dendrites. Their purpose is to receive, conduct, and transmit impulses in the nervous system.
• GO:0051402 Neuron apoptotic process
  Any apoptotic process in a neuron, the basic cellular unit of nervous tissue. Each neuron consists of a body, an axon, and dendrites. Their purpose is to receive, conduct, and transmit impulses in the nervous system.
• GO:0051726 Regulation of cell cycle
  Any process that modulates the rate or extent of progression through the cell cycle.
• GO:0051726 Regulation of cell cycle
  Any process that modulates the rate or extent of progression through the cell cycle.
• GO:0051974 Negative regulation of telomerase activity
  Any process that stops or reduces the activity of the enzyme telomerase, which catalyzes of the reaction: deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).
• GO:0060333 Interferon-gamma-mediated signaling pathway
  A series of molecular signals initiated by the binding of interferon-gamma to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription. Interferon gamma is the only member of the type II interferon found so far.
• GO:0060411 Cardiac septum morphogenesis
  The process in which the anatomical structure of a cardiac septum is generated and organized. A cardiac septum is a partition that separates parts of the heart.
• GO:0061419 Positive regulation of transcription from RNA polymerase II promoter in response to hypoxia
  Any process that increases the frequency, rate or extent of transcription from an RNA polymerase II promoter as a result of a hypoxia stimulus.
• GO:0070059 Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
  A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced in response to a stimulus indicating endoplasmic reticulum (ER) stress, and ends when the execution phase of apoptosis is triggered. ER stress usually results from the accumulation of unfolded or misfolded proteins in the ER lumen.
• GO:0070243 Regulation of thymocyte apoptotic process
  Any process that modulates the occurrence or rate of thymocyte death by apoptotic process.
• GO:0070245 Positive regulation of thymocyte apoptotic process
  Any process that activates or increases the frequency, rate or extent of thymocyte death by apoptotic process.
• GO:0070266 Necroptotic process
  A programmed necrotic cell death process which begins when a cell receives a signal (e.g. a ligand binding to a death receptor or to a Toll-like receptor), and proceeds through a series of biochemical events (signaling pathways), characterized by activation of receptor-interacting serine/threonine-protein kinase 1 and/or 3 (RIPK1/3, also called RIP1/3) and by critical dependence on mixed lineage kinase domain-like (MLKL), and which typically lead to common morphological features of necrotic cell death. The process ends when the cell has died. The process is divided into a signaling phase, and an execution phase, which is triggered by the former.
• GO:0071158 Positive regulation of cell cycle arrest
  Any process that increases the rate, frequency, or extent of cell cycle arrest, the process in which the cell cycle is halted during one of the normal phases.
• GO:0071479 Cellular response to ionizing radiation
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a ionizing radiation stimulus. Ionizing radiation is radiation with sufficient energy to remove electrons from atoms and may arise from spontaneous decay of unstable isotopes, resulting in alpha and beta particles and gamma rays. Ionizing radiation also includes X-rays.
• GO:0071479 Cellular response to ionizing radiation
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a ionizing radiation stimulus. Ionizing radiation is radiation with sufficient energy to remove electrons from atoms and may arise from spontaneous decay of unstable isotopes, resulting in alpha and beta particles and gamma rays. Ionizing radiation also includes X-rays.
• GO:0071479 Cellular response to ionizing radiation
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a ionizing radiation stimulus. Ionizing radiation is radiation with sufficient energy to remove electrons from atoms and may arise from spontaneous decay of unstable isotopes, resulting in alpha and beta particles and gamma rays. Ionizing radiation also includes X-rays.
• GO:0071480 Cellular response to gamma radiation
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a gamma radiation stimulus. Gamma radiation is a form of electromagnetic radiation (EMR) or light emission of a specific frequency produced from sub-atomic particle interaction, such as electron-positron annihilation and radioactive decay. Gamma rays are generally characterized as EMR having the highest frequency and energy, and also the shortest wavelength, within the electromagnetic radiation spectrum.
• GO:0071480 Cellular response to gamma radiation
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a gamma radiation stimulus. Gamma radiation is a form of electromagnetic radiation (EMR) or light emission of a specific frequency produced from sub-atomic particle interaction, such as electron-positron annihilation and radioactive decay. Gamma rays are generally characterized as EMR having the highest frequency and energy, and also the shortest wavelength, within the electromagnetic radiation spectrum.
• GO:0071494 Cellular response to UV-C
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a UV-C radiation stimulus. UV-C radiation (UV-C light) spans the wavelengths 100 to 280 nm.
• GO:0071850 Mitotic cell cycle arrest
  The process in which the mitotic cell cycle is halted during one of the normal phases (G1, S, G2, M).
• GO:0072331 Signal transduction by p53 class mediator
  An intracellular signaling process that is induced by the cell cycle regulator phosphoprotein p53 or an equivalent protein.
• GO:0072332 Intrinsic apoptotic signaling pathway by p53 class mediator
  A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, and ends when the execution phase of apoptosis is triggered.
• GO:0072332 Intrinsic apoptotic signaling pathway by p53 class mediator
  A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, and ends when the execution phase of apoptosis is triggered.
• GO:0072332 Intrinsic apoptotic signaling pathway by p53 class mediator
  A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, and ends when the execution phase of apoptosis is triggered.
• GO:0072363 Regulation of glycolytic process by positive regulation of transcription from RNA polymerase II promoter
  Any process that modulates the frequency, rate or extent of glycolysis by activating or increasing the frequency, rate or extent of transcription from an RNA polymerase II promoter.
• GO:0072717 Cellular response to actinomycin D
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an actinomycin D stimulus.
• GO:0090200 Positive regulation of release of cytochrome c from mitochondria
  Any process that increases the rate, frequency or extent of release of cytochrome c from mitochondria, the process in which cytochrome c is enabled to move from the mitochondrial intermembrane space into the cytosol, which is an early step in apoptosis and leads to caspase activation.
• GO:0090200 Positive regulation of release of cytochrome c from mitochondria
  Any process that increases the rate, frequency or extent of release of cytochrome c from mitochondria, the process in which cytochrome c is enabled to move from the mitochondrial intermembrane space into the cytosol, which is an early step in apoptosis and leads to caspase activation.
• GO:0090343 Positive regulation of cell aging
  Any process that increases the rate, frequency, or extent of cell aging. Cell aging is the progression of the cell from its inception to the end of its lifespan.
• GO:0090399 Replicative senescence
  A cell aging process associated with the dismantling of a cell as a response to telomere shortening and/or cellular aging.
• GO:0090403 Oxidative stress-induced premature senescence
  A cellular senescence process associated with the dismantling of a cell as a response to oxidative stress, e.g. high levels of reactive oxygen species, such as superoxide anions, hydrogen peroxide, and hydroxyl radicals.
• GO:0097252 Oligodendrocyte apoptotic process
  Any apoptotic process in an oligodendrocyte. Oligodendrocytes belong to a class of large neuroglial (macroglial) cells in the central nervous system, where they form the insulating myelin sheath of axons.
• GO:0097252 Oligodendrocyte apoptotic process
  Any apoptotic process in an oligodendrocyte. Oligodendrocytes belong to a class of large neuroglial (macroglial) cells in the central nervous system, where they form the insulating myelin sheath of axons.
• GO:1900119 Positive regulation of execution phase of apoptosis
  Any process that activates or increases the frequency, rate or extent of execution phase of apoptosis.
• GO:1901525 Negative regulation of macromitophagy
  Any process that stops, prevents or reduces the frequency, rate or extent of macromitophagy.
• GO:1902108 Regulation of mitochondrial membrane permeability involved in apoptotic process
  Any regulation of mitochondrial membrane permeability that is involved in apoptotic process.
• GO:1902253 Regulation of intrinsic apoptotic signaling pathway by p53 class mediator
  Any process that modulates the frequency, rate or extent of intrinsic apoptotic signaling pathway by p53 class mediator.
• GO:1904024 Negative regulation of glucose catabolic process to lactate via pyruvate
  Any process that stops, prevents or reduces the frequency, rate or extent of glucose catabolic process to lactate via pyruvate.
• GO:1990144 Intrinsic apoptotic signaling pathway in response to hypoxia
  A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced in response to hypoxia (lowered oxygen tension). Hypoxia, defined as a decline in O2 levels below normoxic levels of 20.8 - 20.95%, results in metabolic adaptation at both the cellular and organismal level. The pathway ends when the execution phase of apoptosis is triggered.
• GO:1990440 Positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress
  Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter as a result of an endoplasmic reticulum stress.
• GO:2000269 Regulation of fibroblast apoptotic process
  Any process that modulates the frequency, rate or extent of fibroblast apoptotic process.
• GO:2000378 Negative regulation of reactive oxygen species metabolic process
  Any process that stops, prevents or reduces the frequency, rate or extent of reactive oxygen species metabolic process.
• GO:2000379 Positive regulation of reactive oxygen species metabolic process
  Any process that activates or increases the frequency, rate or extent of reactive oxygen species metabolic process.
• GO:2000772 Regulation of cellular senescence
  Any process that modulates the frequency, rate or extent of cellular senescence.
• GO:2001244 Positive regulation of intrinsic apoptotic signaling pathway
  Any process that activates or increases the frequency, rate or extent of intrinsic apoptotic signaling pathway.

Protein Sequence

>P02340
MEESQSDISLELPLSQETFSGLWKLLPPEDILPSPHCMDDLLLPQDVEEFFEGPSEALRVSGAPAAQDPVTETPGPVAPA
PATPWPLSSFVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKS
QHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGM
NRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGE
YFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSRAHSSYLKTKKGQSTSRHKKTMVKKVGPDSD