FGR Tyrosine-protein kinase Fgr

• Overview
• Annotations

UniProt Data

Enzyme Annotations (1)

• EC:2.7.10.2 Non-specific protein-tyrosine kinase.
  ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

GO Annotations

Cellular component (7)

• GO:0005576 Extracellular region
  The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
• GO:0005886 Plasma membrane
  The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
• GO:0005886 Plasma membrane
  The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
• GO:0016235 Aggresome
  An inclusion body formed by dynein-dependent retrograde transport of an aggregated protein on microtubules.
• GO:0034774 Secretory granule lumen
  The volume enclosed by the membrane of a secretory granule.
• GO:0070062 Extracellular exosome
  A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Molecular function (11)

• GO:0001784 Phosphotyrosine binding
  Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein.
• GO:0001784 Phosphotyrosine binding
  Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein.
• GO:0004713 Protein tyrosine kinase activity
  Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
• GO:0004713 Protein tyrosine kinase activity
  Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
• GO:0004713 Protein tyrosine kinase activity
  Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
• GO:0004715 Non-membrane spanning protein tyrosine kinase activity
  Catalysis of the reaction: ATP + protein L-tyrosine = ADP + protein L-tyrosine phosphate by a non-membrane spanning protein.
• GO:0004715 Non-membrane spanning protein tyrosine kinase activity
  Catalysis of the reaction: ATP + protein L-tyrosine = ADP + protein L-tyrosine phosphate by a non-membrane spanning protein.
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
• GO:0019901 Protein kinase binding
  Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
• GO:0034987 Immunoglobulin receptor binding
  Interacting selectively and non-covalently with one or more specific sites on an immunoglobulin receptor molecule.
• GO:0034988 Fc-gamma receptor I complex binding
  Interacting selectively and non-covalently with one or more specific sites on the Fc-gamma receptor I complex. The complex functions primarily as an activating receptor for IgG.

Biological process (19)

• GO:0002768 Immune response-regulating cell surface receptor signaling pathway
  A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell capable of activating, perpetuating, or inhibiting an immune response.
• GO:0006468 Protein phosphorylation
  The process of introducing a phosphate group on to a protein.
• GO:0007229 Integrin-mediated signaling pathway
  A series of molecular signals initiated by the binding of extracellular ligand to an integrin on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0007229 Integrin-mediated signaling pathway
  A series of molecular signals initiated by the binding of extracellular ligand to an integrin on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0008360 Regulation of cell shape
  Any process that modulates the surface configuration of a cell.
• GO:0009615 Response to virus
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus from a virus.
• GO:0014068 Positive regulation of phosphatidylinositol 3-kinase signaling
  Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
• GO:0018108 Peptidyl-tyrosine phosphorylation
  The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
• GO:0030335 Positive regulation of cell migration
  Any process that activates or increases the frequency, rate or extent of cell migration.
• GO:0038096 Fc-gamma receptor signaling pathway involved in phagocytosis
  An Fc-gamma receptor signaling pathway that contributes to the endocytic engulfment of external particulate material by phagocytes.
• GO:0043306 Positive regulation of mast cell degranulation
  Any process that activates or increases the frequency, rate or extent of mast cell degranulation.
• GO:0043312 Neutrophil degranulation
  The regulated exocytosis of secretory granules containing preformed mediators such as proteases, lipases, and inflammatory mediators by a neutrophil.
• GO:0043552 Positive regulation of phosphatidylinositol 3-kinase activity
  Any process that activates or increases the frequency, rate or extent of phosphatidylinositol 3-kinase activity.
• GO:0045088 Regulation of innate immune response
  Any process that modulates the frequency, rate or extent of the innate immune response, the organism's first line of defense against infection.
• GO:0045859 Regulation of protein kinase activity
  Any process that modulates the frequency, rate or extent of protein kinase activity.
• GO:0046777 Protein autophosphorylation
  The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
• GO:0050715 Positive regulation of cytokine secretion
  Any process that activates or increases the frequency, rate or extent of the regulated release of cytokines from a cell.
• GO:0050764 Regulation of phagocytosis
  Any process that modulates the frequency, rate or extent of phagocytosis, the process in which phagocytes engulf external particulate material.
• GO:0050830 Defense response to Gram-positive bacterium
  Reactions triggered in response to the presence of a Gram-positive bacterium that act to protect the cell or organism.

Protein Sequence

>P09769
MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVT
LFIALYDYEARTEDDLTFTKGEKFHILNNTEGDWWEARSLSSGKTGCIPSNYVAPVDSIQAEEWYFGKIGRKDAERQLLS
PGNPQGAFLIRESETTKGAYSLSIRDWDQTRGDHVKHYKIRKLDMGGYYITTRVQFNSVQELVQHYMEVNDGLCNLLIAP
CTIMKPQTLGLAKDAWEISRSSITLERRLGTGCFGDVWLGTWNGSTKVAVKTLKPGTMSPKAFLEEAQVMKLLRHDKLVQ
LYAVVSEEPIYIVTEFMCHGSLLDFLKNPEGQDLRLPQLVDMAAQVAEGMAYMERMNYIHRDLRAANILVGERLACKIAD
FGLARLIKDDEYNPCQGSKFPIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMNKREVLEQVEQGYHMPCP
PGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQT