Fgr Tyrosine-protein kinase Fgr

• Overview
• Annotations

UniProt Data

Enzyme Annotations (1)

• EC:2.7.10.2 Non-specific protein-tyrosine kinase.
  ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

GO Annotations

Cellular component (4)

• GO:0005886 Plasma membrane
  The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
• GO:0005886 Plasma membrane
  The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
• GO:0016235 Aggresome
  An inclusion body formed by dynein-dependent retrograde transport of an aggregated protein on microtubules.
• GO:0070062 Extracellular exosome
  A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Molecular function (10)

• GO:0001784 Phosphotyrosine binding
  Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein.
• GO:0001784 Phosphotyrosine binding
  Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein.
• GO:0004713 Protein tyrosine kinase activity
  Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
• GO:0004715 Non-membrane spanning protein tyrosine kinase activity
  Catalysis of the reaction: ATP + protein L-tyrosine = ADP + protein L-tyrosine phosphate by a non-membrane spanning protein.
• GO:0004715 Non-membrane spanning protein tyrosine kinase activity
  Catalysis of the reaction: ATP + protein L-tyrosine = ADP + protein L-tyrosine phosphate by a non-membrane spanning protein.
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
• GO:0019901 Protein kinase binding
  Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
• GO:0019901 Protein kinase binding
  Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
• GO:0034987 Immunoglobulin receptor binding
  Interacting selectively and non-covalently with one or more specific sites on an immunoglobulin receptor molecule.
• GO:0034988 Fc-gamma receptor I complex binding
  Interacting selectively and non-covalently with one or more specific sites on the Fc-gamma receptor I complex. The complex functions primarily as an activating receptor for IgG.

Biological process (17)

• GO:0007229 Integrin-mediated signaling pathway
  A series of molecular signals initiated by the binding of extracellular ligand to an integrin on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0007229 Integrin-mediated signaling pathway
  A series of molecular signals initiated by the binding of extracellular ligand to an integrin on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0008360 Regulation of cell shape
  Any process that modulates the surface configuration of a cell.
• GO:0014068 Positive regulation of phosphatidylinositol 3-kinase signaling
  Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
• GO:0018108 Peptidyl-tyrosine phosphorylation
  The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
• GO:0018108 Peptidyl-tyrosine phosphorylation
  The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
• GO:0030335 Positive regulation of cell migration
  Any process that activates or increases the frequency, rate or extent of cell migration.
• GO:0032956 Regulation of actin cytoskeleton organization
  Any process that modulates the frequency, rate or extent of the formation, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
• GO:0043306 Positive regulation of mast cell degranulation
  Any process that activates or increases the frequency, rate or extent of mast cell degranulation.
• GO:0043552 Positive regulation of phosphatidylinositol 3-kinase activity
  Any process that activates or increases the frequency, rate or extent of phosphatidylinositol 3-kinase activity.
• GO:0045088 Regulation of innate immune response
  Any process that modulates the frequency, rate or extent of the innate immune response, the organism's first line of defense against infection.
• GO:0045859 Regulation of protein kinase activity
  Any process that modulates the frequency, rate or extent of protein kinase activity.
• GO:0046777 Protein autophosphorylation
  The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
• GO:0050715 Positive regulation of cytokine secretion
  Any process that activates or increases the frequency, rate or extent of the regulated release of cytokines from a cell.
• GO:0050764 Regulation of phagocytosis
  Any process that modulates the frequency, rate or extent of phagocytosis, the process in which phagocytes engulf external particulate material.
• GO:0050830 Defense response to Gram-positive bacterium
  Reactions triggered in response to the presence of a Gram-positive bacterium that act to protect the cell or organism.
• GO:0050830 Defense response to Gram-positive bacterium
  Reactions triggered in response to the presence of a Gram-positive bacterium that act to protect the cell or organism.

Protein Sequence

>P14234
MGCVFCKKLEPASKEDVGLEGDFRSQTAEERYFPDPTQGRTSSVFPQPTSPAFLNTGNMRSISGTGVTIFVALYDYEART
GDDLTFTKGEKFHILNNTEYDWWEARSLSSGHRGYVPSNYVAPVDSIQAEEWYFGKISRKDAERQLLSSGNPQGAFLIRE
SETTKGAYSLSIRDWDQNRGDHIKHYKIRKLDTGGYYITTRAQFDSIQDLVRHYMEVNDGLCYLLTAPCTTTKPQTLGLA
KDAWEIDRNSIALERRLGTGCFGDVWLGTWNCSTKVAVKTLKPGTMSPKAFLEEAQIMKLLRHDKLVQLYAVVSEEPIYI
VTEFMCYGSLLDFLKDREGQNLMLPHLVDMAAQVAEGMAYMERMNYIHRDLRAANILVGEYLICKIADFGLARLIEDNEY
NPQQGTKFPIKWTAPEAALFGRFTVKSDVWSFGILLTELITKGRVPYPGMNNREVLEQVEHGYHMPCPPGCPASLYEVME
QAWRLDPEERPTFEYLQSFLEDYFTSTEPQYQPGDQT