TP53BP2 Apoptosis-stimulating of p53 protein 2

• Overview
• Annotations

UniProt Data

Enzyme Annotations (0)

GO Annotations

Cellular component (5)

• GO:0005634 Nucleus
  A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
• GO:0005654 Nucleoplasm
  That part of the nuclear content other than the chromosomes or the nucleolus.
• GO:0005737 Cytoplasm
  All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
• GO:0005737 Cytoplasm
  All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
• GO:0048471 Perinuclear region of cytoplasm
  Cytoplasm situated near, or occurring around, the nucleus.

Molecular function (5)

• GO:0002039 P53 binding
  Interacting selectively and non-covalently with one of the p53 family of proteins.
• GO:0005070 SH3/SH2 adaptor activity
  Interacting selectively and non-covalently and simultaneously with one or more signal transduction molecules, usually acting as a scaffold to bring these molecules into close proximity either using their own SH2/SH3 domains (e.g. Grb2) or those of their target molecules (e.g. SAM68).
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
• GO:0042802 Identical protein binding
  Interacting selectively and non-covalently with an identical protein or proteins.
• GO:0051059 NF-kappaB binding
  Interacting selectively and non-covalently with NF-kappaB, a transcription factor for eukaryotic RNA polymerase II promoters.

Biological process (7)

• GO:0007165 Signal transduction
  The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
• GO:0042981 Regulation of apoptotic process
  Any process that modulates the occurrence or rate of cell death by apoptotic process.
• GO:0045786 Negative regulation of cell cycle
  Any process that stops, prevents or reduces the rate or extent of progression through the cell cycle.
• GO:0072332 Intrinsic apoptotic signaling pathway by p53 class mediator
  A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, and ends when the execution phase of apoptosis is triggered.
• GO:1900119 Positive regulation of execution phase of apoptosis
  Any process that activates or increases the frequency, rate or extent of execution phase of apoptosis.
• GO:1900740 Positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway
  Any process that activates or increases the frequency, rate or extent of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway.
• GO:1901796 Regulation of signal transduction by p53 class mediator
  Any process that modulates the frequency, rate or extent of signal transduction by p53 class mediator.

Protein Sequence

>Q13625
MMPMFLTVYLSNNEQHFTEVPVTPETICRDVVDLCKEPGESDCHLAEVWCGSERPVADNERMFDVLQRFGSQRNEVRFFL
RHERPPGRDIVSGPRSQDPSLKRNGVKVPGEYRRKENGVNSPRMDLTLAELQEMASRQQQQIEAQQQLLATKEQRLKFLK
QQDQRQQQQVAEQEKLKRLKEIAENQEAKLKKVRALKGHVEQKRLSNGKLVEEIEQMNNLFQQKQRELVLAVSKVEELTR
QLEMLKNGRIDSHHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKRNSEVAVMDKRVNELRDRLWKKKAALQ
QKENLPVSSDGNLPQQAASAPSRVAAVGPYIQSSTMPRMPSRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQ
TKGSKIHPVGPDWSPSNADLFPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQS
SEDILRDAQVANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIP
SVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRKPQTVAASSIYSMYTQQQAPGKNFQQAVQSALTKTHTRGPH
FSSVYGKPVIAAAQNQQQHPENIYSNSQGKPGSPEPETEPVSSVQENHENERIPRPLSPTKLLPFLSNPYRNQSDADLEA
LRKKLSNAPRPLKKRSSITEPEGPNGPNIQKLLYQRTTIAAMETISVPSYPSKSASVTASSESPVEIQNPYLHVEPEKEV
VSLVPESLSPEDVGNASTENSDMPAPSPGLDYEPEGVPDNSPNLQNNPEEPNPEAPHVLDVYLEEYPPYPPPPYPSGEPE
GPGEDSVSMRPPEITGQVSLPPGKRTNLRKTGSERIAHGMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGI
TALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGY
TQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRI
KPRQRSLA