Mus musculus

UniProt Data

Accession Q4JIM5 [ UniProt ]
Name ABL2_MOUSE
Description Abelson tyrosine-protein kinase 2
Species Mus musculus
Sequence Length1182

Enzyme Annotations (1)

  • EC:2.7.10.2 Non-specific protein-tyrosine kinase.
    ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

GO Annotations

Cellular component (5)

  • GO:0001891 Phagocytic cup
    An invagination of the cell membrane formed by an actin dependent process during phagocytosis. Following internalization it is converted into a phagosome.
  • GO:0015629 Actin cytoskeleton
    The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
  • GO:0030027 Lamellipodium
    A thin sheetlike process extended by the leading edge of a migrating cell or extending cell process; contains a dense meshwork of actin filaments.
  • GO:0031410 Cytoplasmic vesicle
    A vesicle found in the cytoplasm of a cell.
  • GO:0043197 Dendritic spine
    A small, membranous protrusion from a dendrite that forms a postsynaptic compartment - typically receiving input from a single presynapse. They function as partially isolated biochemical and an electrical compartments. Spine morphology is variable including \thin\, \stubby\, \mushroom\, and \branched\, with a continuum of intermediate morphologies. They typically terminate in a bulb shape, linked to the dendritic shaft by a restriction. Spine remodeling is though to be involved in synaptic plasticity.

Molecular function (10)

  • GO:0000287 Magnesium ion binding
    Interacting selectively and non-covalently with magnesium (Mg) ions.
  • GO:0000287 Magnesium ion binding
    Interacting selectively and non-covalently with magnesium (Mg) ions.
  • GO:0001784 Phosphotyrosine binding
    Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein.
  • GO:0004713 Protein tyrosine kinase activity
    Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
  • GO:0004713 Protein tyrosine kinase activity
    Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
  • GO:0004713 Protein tyrosine kinase activity
    Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
  • GO:0004713 Protein tyrosine kinase activity
    Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
  • GO:0005515 Protein binding
    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
  • GO:0030145 Manganese ion binding
    Interacting selectively and non-covalently with manganese (Mn) ions.
  • GO:0030145 Manganese ion binding
    Interacting selectively and non-covalently with manganese (Mn) ions.

Biological process (52)

  • GO:0001843 Neural tube closure
    The last step in the formation of the neural tube, where the paired neural folds are brought together and fuse at the dorsal midline.
  • GO:0002118 Aggressive behavior
    A behavioral interaction between organisms in which one organism has the intention of inflicting physical damage on another individual.
  • GO:0006468 Protein phosphorylation
    The process of introducing a phosphate group on to a protein.
  • GO:0006909 Phagocytosis
    An endocytosis process that results in the engulfment of external particulate material by phagocytes. The particles are initially contained within phagocytic vacuoles (phagosomes), which then fuse with primary lysosomes to effect digestion of the particles.
  • GO:0006909 Phagocytosis
    An endocytosis process that results in the engulfment of external particulate material by phagocytes. The particles are initially contained within phagocytic vacuoles (phagosomes), which then fuse with primary lysosomes to effect digestion of the particles.
  • GO:0006930 Substrate-dependent cell migration, cell extension
    The formation of a cell surface protrusion, such as a lamellipodium or filopodium, at the leading edge of a migrating cell.
  • GO:0007015 Actin filament organization
    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments. Includes processes that control the spatial distribution of actin filaments, such as organizing filaments into meshworks, bundles, or other structures, as by cross-linking.
  • GO:0007173 Epidermal growth factor receptor signaling pathway
    A series of molecular signals initiated by binding of a ligand to the tyrosine kinase receptor EGFR (ERBB1) on the surface of a cell. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
  • GO:0007204 Positive regulation of cytosolic calcium ion concentration
    Any process that increases the concentration of calcium ions in the cytosol.
  • GO:0007612 Learning
    Any process in an organism in which a relatively long-lasting adaptive behavioral change occurs as the result of experience.
  • GO:0007628 Adult walking behavior
    The behavior of an adult relating to the progression of that organism along the ground by the process of lifting and setting down each leg.
  • GO:0008542 Visual learning
    Any process in an organism in which a change in behavior of an individual occurs in response to repeated exposure to a visual cue.
  • GO:0009791 Post-embryonic development
    The process whose specific outcome is the progression of the organism over time, from the completion of embryonic development to the mature structure. See embryonic development.
  • GO:0010863 Positive regulation of phospholipase C activity
    Any process that increases the rate of phospholipase C activity.
  • GO:0010976 Positive regulation of neuron projection development
    Any process that increases the rate, frequency or extent of neuron projection development. Neuron projection development is the process whose specific outcome is the progression of a neuron projection over time, from its formation to the mature structure. A neuron projection is any process extending from a neural cell, such as axons or dendrites (collectively called neurites).
  • GO:0010976 Positive regulation of neuron projection development
    Any process that increases the rate, frequency or extent of neuron projection development. Neuron projection development is the process whose specific outcome is the progression of a neuron projection over time, from its formation to the mature structure. A neuron projection is any process extending from a neural cell, such as axons or dendrites (collectively called neurites).
  • GO:0016322 Neuron remodeling
    The developmentally regulated remodeling of neuronal projections such as pruning to eliminate the extra dendrites and axons projections set up in early stages of nervous system development.
  • GO:0018108 Peptidyl-tyrosine phosphorylation
    The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
  • GO:0018108 Peptidyl-tyrosine phosphorylation
    The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
  • GO:0021587 Cerebellum morphogenesis
    The process in which the anatomical structure of the cerebellum is generated and organized. The cerebellum is the portion of the brain in the back of the head between the cerebrum and the pons. The cerebellum controls balance for walking and standing, modulates the force and range of movement and is involved in the learning of motor skills.
  • GO:0022408 Negative regulation of cell-cell adhesion
    Any process that stops, prevents or reduces the rate or extent of cell adhesion to another cell.
  • GO:0022414 Reproductive process
    A biological process that directly contributes to the process of producing new individuals by one or two organisms. The new individuals inherit some proportion of their genetic material from the parent or parents.
  • GO:0030036 Actin cytoskeleton organization
    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
  • GO:0030036 Actin cytoskeleton organization
    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
  • GO:0030182 Neuron differentiation
    The process in which a relatively unspecialized cell acquires specialized features of a neuron.
  • GO:0031223 Auditory behavior
    The behavior of an organism in response to a sound.
  • GO:0032092 Positive regulation of protein binding
    Any process that activates or increases the frequency, rate or extent of protein binding.
  • GO:0034613 Cellular protein localization
    Any process in which a protein is transported to, and/or maintained in, a specific location at the level of a cell. Localization at the cellular level encompasses movement within the cell, from within the cell to the cell surface, or from one location to another at the surface of a cell.
  • GO:0035024 Negative regulation of Rho protein signal transduction
    Any process that stops, prevents, or reduces the frequency, rate or extent of Rho protein signal transduction.
  • GO:0035264 Multicellular organism growth
    The increase in size or mass of an entire multicellular organism, as opposed to cell growth.
  • GO:0035640 Exploration behavior
    The specific behavior of an organism in response to a novel environment or stimulus.
  • GO:0043123 Positive regulation of I-kappaB kinase/NF-kappaB signaling
    Any process that activates or increases the frequency, rate or extent of I-kappaB kinase/NF-kappaB signaling.
  • GO:0046632 Alpha-beta T cell differentiation
    The process in which a precursor cell type acquires the specialized features of an alpha-beta T cell. An alpha-beta T cell is a T cell that expresses an alpha-beta T cell receptor complex.
  • GO:0048008 Platelet-derived growth factor receptor signaling pathway
    The series of molecular signals generated as a consequence of a platelet-derived growth factor receptor binding to one of its physiological ligands.
  • GO:0048813 Dendrite morphogenesis
    The process in which the anatomical structures of a dendrite are generated and organized. A dendrite is a freely branching protoplasmic process of a nerve cell.
  • GO:0048813 Dendrite morphogenesis
    The process in which the anatomical structures of a dendrite are generated and organized. A dendrite is a freely branching protoplasmic process of a nerve cell.
  • GO:0050885 Neuromuscular process controlling balance
    Any process that an organism uses to control its balance, the orientation of the organism (or the head of the organism) in relation to the source of gravity. In humans and animals, balance is perceived through visual cues, the labyrinth system of the inner ears and information from skin pressure receptors and muscle and joint receptors.
  • GO:0050885 Neuromuscular process controlling balance
    Any process that an organism uses to control its balance, the orientation of the organism (or the head of the organism) in relation to the source of gravity. In humans and animals, balance is perceived through visual cues, the labyrinth system of the inner ears and information from skin pressure receptors and muscle and joint receptors.
  • GO:0051017 Actin filament bundle assembly
    The assembly of actin filament bundles; actin filaments are on the same axis but may be oriented with the same or opposite polarities and may be packed with different levels of tightness.
  • GO:0051353 Positive regulation of oxidoreductase activity
    Any process that activates or increases the frequency, rate or extent of oxidoreductase activity, the catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered.
  • GO:0060020 Bergmann glial cell differentiation
    The process in which neuroepithelial cells of the neural tube give rise to Brgmann glial cells, specialized bipotential progenitors cells of the cerebellum. Differentiation includes the processes involved in commitment of a cell to a specific fate.
  • GO:0060563 Neuroepithelial cell differentiation
    The process in which epiblast cells acquire specialized features of neuroepithelial cells.
  • GO:0070374 Positive regulation of ERK1 and ERK2 cascade
    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
  • GO:0071300 Cellular response to retinoic acid
    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a retinoic acid stimulus.
  • GO:0072358 Cardiovascular system development
    The process whose specific outcome is the progression of the cardiovascular system over time, from its formation to the mature structure. The cardiovascular system is the anatomical system that has as its parts the heart and blood vessels.
  • GO:0097062 Dendritic spine maintenance
    The organization process that preserves a dendritic spine in a stable functional or structural state. A dendritic spine is a specialized protrusion from a neuronal dendrite and is involved in synaptic transmission.
  • GO:0097062 Dendritic spine maintenance
    The organization process that preserves a dendritic spine in a stable functional or structural state. A dendritic spine is a specialized protrusion from a neuronal dendrite and is involved in synaptic transmission.
  • GO:1900042 Positive regulation of interleukin-2 secretion
    Any process that activates or increases the frequency, rate or extent of interleukin-2 secretion.
  • GO:1902715 Positive regulation of interferon-gamma secretion
    Any process that activates or increases the frequency, rate or extent of interferon-gamma secretion.
  • GO:1903053 Regulation of extracellular matrix organization
    Any process that modulates the frequency, rate or extent of extracellular matrix organization.
  • GO:2000096 Positive regulation of Wnt signaling pathway, planar cell polarity pathway
    Any process that activates or increases the frequency, rate or extent of Wnt signaling pathway, planar cell polarity pathway.
  • GO:2000352 Negative regulation of endothelial cell apoptotic process
    Any process that stops, prevents or reduces the frequency, rate or extent of endothelial cell apoptotic process.

Protein Sequence

>Q4JIM5
MGQQVGRVGEAPGLQQPQPRGIRGSSAARPSGRRRDPAGRTADAGFNVFTQHDHFASCVEDGFEGDKTGGSSPEVLHRPF
GCDAESQALNEAIRWSSKENLLGATESDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSN
YITPVNSLEKHSWYHGPVSRSAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTTTDSKVYVTAESRFST
LAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYGEVYVGVWKKYSLTVAVKTFK
EDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTEYMPYGNLLDYLRECSREEVTAVVLLYMATQISSAMEYL
EKKNFIHRDLAARNCLVGENHVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIAT
YGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEELGRTA
SSSSVVPYLPRLPLLPSKTRTLRKQGENKENLDGGLDAAESLASSSAPAGFIRSTQASSGSPALPRKQRDKSPSSLLEDA
KETCFTRDRKGGFFSSFMKKRNAPTPPKRSSSFREMENQPHKKYELTGNFSPVASLQNADGFSVAPSQQEPNLVPAKCYG
GSFAQRNLCADDDSGGGGGSGTAGGGWSGITGFFTPRLIKKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMA
MTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEEGAAPARERPKAKLLPRGATALPLRAPDPAITESDSPGVG
VAGVAAAPKGKERNGGTRLGVAGVPEDGEQLGWSSPAKAVAVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKL
LSEHQVTSSGDKDRPRRVKPKCAPPPPPVMRLLQHPSTCSDPEEEPTAPPAGQHTPETQEGGKKAAPGPVPSSGKPGRPV
MPPPQVPLPTSSISPAKMANGTAGTKVALRKTKQAAEKISADKISKEALLECADLLSSAITEPVPNSQLVDTGHQLLDYC
SGYVDSIPQTRNKFAFREAVSKLELSLQELQVSSTAAGVPGTNPVLNNLLSCVQEISDVVQR