Ppp1r13b Apoptosis-stimulating of p53 protein 1

• Overview
• Annotations

UniProt Data

Enzyme Annotations (0)

GO Annotations

Cellular component (5)

• GO:0005634 Nucleus
  A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
• GO:0005634 Nucleus
  A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
• GO:0005654 Nucleoplasm
  That part of the nuclear content other than the chromosomes or the nucleolus.
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
• GO:0005886 Plasma membrane
  The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Molecular function (1)

Biological process (2)

• GO:0072332 Intrinsic apoptotic signaling pathway by p53 class mediator
  A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, and ends when the execution phase of apoptosis is triggered.
• GO:0072332 Intrinsic apoptotic signaling pathway by p53 class mediator
  A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, and ends when the execution phase of apoptosis is triggered.

Protein Sequence

>Q62415
MMPMILTVFLSNNEQILTEVPITPETTCRDVVEFCKEPGEGGCHLAEVWRGSERPIPYDHMMYEHLQKWGPRREEVKFFL
RHEDSPTESSEQGARQTQEQRTQRSVVNVPGEKRTENGVGNPRVELTLSELQDMAARQQQQIENQQQMLVAKEQRLHFLK
QQERRQQQSVSENEKLQKLKERVEAQENKLKKIRAMRGQVDYSKIMNGNLSAEIERFSAMFQEKKQEVQTAILRVDQLSQ
QLEDLKKGKLNGFQSYNGRLTGPAAVELKRLYQELQIRNQLNQEQNSKLQQQKELLNKRNMEVAMMDKRISELRERLYGK
KIQLNRVNGTSSPQSPLSTSGRVAAVGPYIQVPSTGGFPLPGDPVKPQSLTIASSAAHGRSKSANDGNWPPLKQNSASVK
STQMTGDWKDSGMEGTLKQGAISSQPLPLSALGATEKLGIEIGKGPPPIPGVGKPLPPSYGTYPSSGPLGPGSTSSLERR
KEGSLPRPGAGPPSRQKPAPLPPASNAPQPGSSQQIQQRISVPPSPTYPPAGPPAFPTGDGKPELPLTVAIRPFLADKGS
RPQSPRKGPQTVNSSSIYSMYLQQATPPKNYQPPAHGTLNKSVKAVYGKPVLPSGSASPSPLPFLHGSLGTGTAQPQPPS
DSAEKEPEQEGPSVPGEGSTVESLPRPLSPTKLTPIVHSPLRYQSDADLEALRRKLANAPRPLKKRSSITEPEGPGGPNI
QKLLYQRFNTLAGGMEGTPFYQPSPSQDFVGTLADMDNGNTNANGNLDEPFPPRPTAPLPEELAPSSDANDNELPSPEPE
ELICPQTTHQTAEPTEDNNNNVAPVPSTEQIPSPVAEAPSEEDQVPPAPLSPVIHPPAASASKRTNLKKPNSERTGHGLR
VRFNPLALLLDASLEGEFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNAADSDGWTPLHCAAS
CNSVHLCKQLVESGAAIFASTISDIETAADKCEEMEEGYIQCSQFLYGVQEKLGVMNKGTVYALWDYEAQNSDELSFHEG
DAITILRRKDENETEWWWARLGDREGYVPKNLLGLYPRIKPRQRTLA