Tp53inp2 Tumor protein p53-inducible nuclear protein 2

• Overview
• Annotations

UniProt Data

Enzyme Annotations (0)

GO Annotations

Cellular component (6)

• GO:0005634 Nucleus
  A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
• GO:0005634 Nucleus
  A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
• GO:0005776 Autophagosome
  A double-membrane-bounded compartment that engulfs endogenous cellular material as well as invading microorganisms to target them to the vacuole/lysosome for degradation as part of macroautophagy.
• GO:0005776 Autophagosome
  A double-membrane-bounded compartment that engulfs endogenous cellular material as well as invading microorganisms to target them to the vacuole/lysosome for degradation as part of macroautophagy.
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Molecular function (1)

Biological process (9)

• GO:0000045 Autophagosome assembly
  The formation of a double membrane-bounded structure, the autophagosome, that occurs when a specialized membrane sac, called the isolation membrane, starts to enclose a portion of the cytoplasm.
• GO:0000045 Autophagosome assembly
  The formation of a double membrane-bounded structure, the autophagosome, that occurs when a specialized membrane sac, called the isolation membrane, starts to enclose a portion of the cytoplasm.
• GO:0001649 Osteoblast differentiation
  The process whereby a relatively unspecialized cell acquires the specialized features of an osteoblast, a mesodermal or neural crest cell that gives rise to bone.
• GO:0001894 Tissue homeostasis
  A homeostatic process involved in the maintenance of an internal steady state within a defined tissue of an organism, including control of cellular proliferation and death and control of metabolic function.
• GO:0006511 Ubiquitin-dependent protein catabolic process
  The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
• GO:0016236 Macroautophagy
  The major inducible pathway for the general turnover of cytoplasmic constituents in eukaryotic cells, it is also responsible for the degradation of active cytoplasmic enzymes and organelles during nutrient starvation. Macroautophagy involves the formation of double-membrane-bounded autophagosomes which enclose the cytoplasmic constituent targeted for degradation in a membrane-bounded structure. Autophagosomes then fuse with a lysosome (or vacuole) releasing single-membrane-bounded autophagic bodies that are then degraded within the lysosome (or vacuole). Though once thought to be a purely non-selective process, it appears that some types of macroautophagy, e.g. macropexophagy, macromitophagy, may involve selective targeting of the targets to be degraded.
• GO:0045893 Positive regulation of transcription, DNA-templated
  Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
• GO:0045893 Positive regulation of transcription, DNA-templated
  Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
• GO:1903828 Negative regulation of cellular protein localization
  Any process that stops, prevents or reduces the frequency, rate or extent of cellular protein localization. Cellular protein localization is any process in which a protein is transported to, and/or maintained in, a specific location and encompasses movement within the cell, from within the cell to the cell surface, or from one location to another at the surface of a cell.

Protein Sequence

>Q8CFU8
MFQRFTSLFFNTPAPPEDSNCPGAFVSEEDEVDGWLIIDLQDSYTAPPDPGASPAPAGRPPPAPSLMDESWFVTPPACFT
AEGPGLGPARLQSNPLEDLLIEHPSMSVYVTGSTIVLESGPPSPHPEAALPDQDLSDGELAPALREPRALHHAAAPMPAR
AVLLEKAGQVRRLQRARQRAERHTLSAKVLQRQNRARESRSRRPKHQGSFIYQPCQRQFNY