p53 p53 protein long form variant 1

• Overview
• Annotations

UniProt Data

Enzyme Annotations (0)

GO Annotations

Cellular component (1)

Molecular function (8)

• GO:0000976 Transcription regulatory region sequence-specific DNA binding
  Interacting selectively and non-covalently with a specific sequence of DNA that is part of a regulatory region that controls transcription of that section of the DNA. The transcribed region might be described as a gene, cistron, or operon.
• GO:0001047 Core promoter binding
  Interacting selectively and non-covalently with the regulatory region composed of the transcription start site and binding sites for the basal transcription machinery. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
• GO:0001085 RNA polymerase II transcription factor binding
  Interacting selectively and non-covalently with an RNA polymerase II transcription factor, any protein required to initiate or regulate transcription by RNA polymerase II.
• GO:0001097 TFIIH-class transcription factor binding
  Interacting selectively and non-covalently with a basal RNA polymerase II transcription factor of the TFIIH class, one of the factors involved in formation of the preinitiation complex (PIC) by RNA polymerase II and defined as a basal or general transcription factor.
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
• GO:0008134 Transcription factor binding
  Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
• GO:0031624 Ubiquitin conjugating enzyme binding
  Interacting selectively and non-covalently with a ubiquitin conjugating enzyme, any of the E2 proteins.
• GO:0031625 Ubiquitin protein ligase binding
  Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.

Biological process (43)

• GO:0006282 Regulation of DNA repair
  Any process that modulates the frequency, rate or extent of DNA repair.
• GO:0006357 Regulation of transcription from RNA polymerase II promoter
  Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter.
• GO:0006357 Regulation of transcription from RNA polymerase II promoter
  Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter.
• GO:0006915 Apoptotic process
  A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
• GO:0006915 Apoptotic process
  A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
• GO:0006919 Activation of cysteine-type endopeptidase activity involved in apoptotic process
  Any process that initiates the activity of the inactive enzyme cysteine-type endopeptidase in the context of an apoptotic process.
• GO:0006974 Cellular response to DNA damage stimulus
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
• GO:0006974 Cellular response to DNA damage stimulus
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
• GO:0007131 Reciprocal meiotic recombination
  The cell cycle process in which double strand breaks are formed and repaired through a double Holliday junction intermediate. This results in the equal exchange of genetic material between non-sister chromatids in a pair of homologous chromosomes. These reciprocal recombinant products ensure the proper segregation of homologous chromosomes during meiosis I and create genetic diversity.
• GO:0007405 Neuroblast proliferation
  The expansion of a neuroblast population by cell division. A neuroblast is any cell that will divide and give rise to a neuron.
• GO:0008219 Cell death
  Any biological process that results in permanent cessation of all vital functions of a cell. A cell should be considered dead when any one of the following molecular or morphological criteria is met: (1) the cell has lost the integrity of its plasma membrane; (2) the cell, including its nucleus, has undergone complete fragmentation into discrete bodies (frequently referred to as apoptotic bodies). The cell corpse (or its fragments) may be engulfed by an adjacent cell in vivo, but engulfment of whole cells should not be considered a strict criteria to define cell death as, under some circumstances, live engulfed cells can be released from phagosomes (see PMID:18045538).
• GO:0008340 Determination of adult lifespan
  The control of viability and duration in the adult phase of the life-cycle.
• GO:0008630 Intrinsic apoptotic signaling pathway in response to DNA damage
  A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the detection of DNA damage, and ends when the execution phase of apoptosis is triggered.
• GO:0008630 Intrinsic apoptotic signaling pathway in response to DNA damage
  A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the detection of DNA damage, and ends when the execution phase of apoptosis is triggered.
• GO:0009267 Cellular response to starvation
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of deprivation of nourishment.
• GO:0009314 Response to radiation
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an electromagnetic radiation stimulus. Electromagnetic radiation is a propagating wave in space with electric and magnetic components. These components oscillate at right angles to each other and to the direction of propagation.
• GO:0009314 Response to radiation
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an electromagnetic radiation stimulus. Electromagnetic radiation is a propagating wave in space with electric and magnetic components. These components oscillate at right angles to each other and to the direction of propagation.
• GO:0009411 Response to UV
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ultraviolet radiation (UV light) stimulus. Ultraviolet radiation is electromagnetic radiation with a wavelength in the range of 10 to 380 nanometers.
• GO:0010212 Response to ionizing radiation
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a ionizing radiation stimulus. Ionizing radiation is radiation with sufficient energy to remove electrons from atoms and may arise from spontaneous decay of unstable isotopes, resulting in alpha and beta particles and gamma rays. Ionizing radiation also includes X-rays.
• GO:0014016 Neuroblast differentiation
  The process in which a relatively unspecialized cell acquires specialized features of a neuroblast. There are at least four stages through which the pluripotent cells of epiblast or blastula become neuroblasts.
• GO:0016239 Positive regulation of macroautophagy
  Any process, such as recognition of nutrient depletion, that activates or increases the rate of macroautophagy to bring cytosolic macromolecules to the vacuole/lysosome for degradation.
• GO:0030330 DNA damage response, signal transduction by p53 class mediator
  A cascade of processes induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage.
• GO:0035234 Ectopic germ cell programmed cell death
  Programmed cell death of an errant germ line cell that is outside the normal migratory path or ectopic to the gonad. This is an important mechanism of regulating germ cell survival within the embryo.
• GO:0040015 Negative regulation of multicellular organism growth
  Any process that stops, prevents, or reduces the frequency, rate or extent of growth of an organism to reach its usual body size.
• GO:0042127 Regulation of cell proliferation
  Any process that modulates the frequency, rate or extent of cell proliferation.
• GO:0042246 Tissue regeneration
  The regrowth of lost or destroyed tissues.
• GO:0042594 Response to starvation
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a starvation stimulus, deprivation of nourishment.
• GO:0042771 Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
  A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage, and ends when the execution phase of apoptosis is triggered.
• GO:0042771 Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
  A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage, and ends when the execution phase of apoptosis is triggered.
• GO:0042771 Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
  A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage, and ends when the execution phase of apoptosis is triggered.
• GO:0045787 Positive regulation of cell cycle
  Any process that activates or increases the rate or extent of progression through the cell cycle.
• GO:0045893 Positive regulation of transcription, DNA-templated
  Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
• GO:0045893 Positive regulation of transcription, DNA-templated
  Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
• GO:0045944 Positive regulation of transcription from RNA polymerase II promoter
  Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
• GO:0046533 Negative regulation of photoreceptor cell differentiation
  Any process that stops, prevents, or reduces the frequency, rate or extent of photoreceptor cell differentiation. An example of this process is found in Drosophila melanogaster.
• GO:0046620 Regulation of organ growth
  Any process that modulates the frequency, rate or extent of growth of an organ of an organism.
• GO:0048477 Oogenesis
  The complete process of formation and maturation of an ovum or female gamete from a primordial female germ cell. Examples of this process are found in Mus musculus and Drosophila melanogaster.
• GO:0060785 Regulation of apoptosis involved in tissue homeostasis
  Any process that modulates the occurrence or rate of cell death by apoptosis that results in the maintenance of the steady-state number of cells within a tissue.
• GO:0071480 Cellular response to gamma radiation
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a gamma radiation stimulus. Gamma radiation is a form of electromagnetic radiation (EMR) or light emission of a specific frequency produced from sub-atomic particle interaction, such as electron-positron annihilation and radioactive decay. Gamma rays are generally characterized as EMR having the highest frequency and energy, and also the shortest wavelength, within the electromagnetic radiation spectrum.
• GO:0072332 Intrinsic apoptotic signaling pathway by p53 class mediator
  A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, and ends when the execution phase of apoptosis is triggered.
• GO:0090278 Negative regulation of peptide hormone secretion
  Any process that decreases the rate, frequency, or extent of the regulated release of a peptide hormone from secretory granules.
• GO:1990248 Regulation of transcription from RNA polymerase II promoter in response to DNA damage
  Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter as a result of DNA damage.
• GO:2000685 Positive regulation of cellular response to X-ray
  Any process that activates or increases the frequency, rate or extent of cellular response to X-ray.

Protein Sequence

>Q8IMZ4
MSLHKSASFSLTFNQNTSIVSRSNSRTIFEAFKEFLDFWDIGNEVSAESAVRVSSNGAFNLPQSFGNESNEYAHLATPVD
PAYGGNNTNNMMQFTNNLEILANNNSDGNNKINACNKFVCHKGTDSEDDSTEVDIKEDIPKTVEVSGSELTTEPMAFLQG
LNSGNLMQFSQQSVLREMMLQDIQIQANTLPKLENHNIGGYCFSMVLDEPPKSLWMYSIPLNKLYIRMNKAFNVDVQFKS
KMPIQPLNLRVFLCFSNDVSAPVVRCQNHLSVEPLTANNAKMRESLLRSENPNSVYCGNAQGKGISERFSVVVPLNMSRS
VTRSGLTRQTLAFKFVCQNSCIGRKETSLVFCLEKACGDIVGQHVIHVKICTCPKRDRIQDERQLNSKKRKSVPEAAEED
EPSKVRRCIAIKTEDTESNDSRDCDDSAAEWNVSRTPDGDYRLAITCPNKEWLLQSIEGMIKEAAAEVLRNPNQENLRRH
ANKLLSLKKRAYELP