dock Dreadlocks, isoform A

• Overview
• Annotations

UniProt Data

Enzyme Annotations (0)

GO Annotations

Cellular component (1)

Molecular function (6)

• GO:0005070 SH3/SH2 adaptor activity
  Interacting selectively and non-covalently and simultaneously with one or more signal transduction molecules, usually acting as a scaffold to bring these molecules into close proximity either using their own SH2/SH3 domains (e.g. Grb2) or those of their target molecules (e.g. SAM68).
• GO:0005070 SH3/SH2 adaptor activity
  Interacting selectively and non-covalently and simultaneously with one or more signal transduction molecules, usually acting as a scaffold to bring these molecules into close proximity either using their own SH2/SH3 domains (e.g. Grb2) or those of their target molecules (e.g. SAM68).
• GO:0005158 Insulin receptor binding
  Interacting selectively and non-covalently with the insulin receptor.
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
• GO:0019901 Protein kinase binding
  Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
• GO:0050839 Cell adhesion molecule binding
  Interacting selectively and non-covalently with a cell adhesion molecule.

Biological process (7)

• GO:0007409 Axonogenesis
  De novo generation of a long process of a neuron, that carries efferent (outgoing) action potentials from the cell body towards target cells. Refers to the morphogenesis or creation of shape or form of the developing axon.
• GO:0007411 Axon guidance
  The chemotaxis process that directs the migration of an axon growth cone to a specific target site in response to a combination of attractive and repulsive cues.
• GO:0007411 Axon guidance
  The chemotaxis process that directs the migration of an axon growth cone to a specific target site in response to a combination of attractive and repulsive cues.
• GO:0007411 Axon guidance
  The chemotaxis process that directs the migration of an axon growth cone to a specific target site in response to a combination of attractive and repulsive cues.
• GO:0007520 Myoblast fusion
  A process in which non-proliferating myoblasts fuse to existing fibers or to myotubes to form new fibers. A myoblast is a mononucleate cell type that, by fusion with other myoblasts, gives rise to the myotubes that eventually develop into skeletal muscle fibers.
• GO:0008286 Insulin receptor signaling pathway
  The series of molecular signals generated as a consequence of the insulin receptor binding to insulin.
• GO:0046627 Negative regulation of insulin receptor signaling pathway
  Any process that stops, prevents, or reduces the frequency, rate or extent of insulin receptor signaling.

Protein Sequence

>Q8IPW2
MAGNMKHGKSQDDVCYVVAKYDYAAQGAQELDLRKNERYLLLDDSKHWWRVQNSRNQSGYVPSNYVKKEKPSLFDSIKKK
VKKGSGSKTLPNCSPSRQVESPTMSRRLPPDPAEAIGTAVVKYNYQAQQPDELSLTKGTRILILEKSNDGWWRGQSGNSV
GWFPSNYTTEDCDNDGEIHTYAMAENVLDIVVALYSFTSNNDQELSFEKGDRLEIVDRPASDPDWYKARNNQGQVGLVPR
NYLQELNDYLATPYRNASASAGNGNGGGSNGGAGGGGGNDSMERRNEGNKPAAQSSGQPIERPNLAGKSWYYGAITRSQC
DTVLNGHGHDGDFLIRDSETNMGDYSVSLKAPGRNKHFRVHVEQNMYCIGQRKFHSLDQLVDHYQRAPIYTNKQGEKLYL
VRSLPKANGT