nck-1 NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family
UniProt Data
Accession | Q95PW9 [ UniProt ] |
Name | Q95PW9_CAEEL |
Description | NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family |
Species | Caenorhabditis elegans |
Sequence Length | 395 |
Enzyme Annotations (0)
GO Annotations
Cellular component (2)
- GO:0005634 Nucleus
A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent. - GO:0005737 Cytoplasm
All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
Molecular function (1)
None predictedBiological process (1)
None predictedProtein Sequence
>Q95PW9 MSEDYVVVKYDYLAQEEQELTIKKNERLKLLDDSKNWWKVMNDSNSVGFVPSNYVRKESIVDKAKGTIKGLARGRNRSSD PEPEERLNGIARLAFSLNNNCAVTPSSNKIPMMSSKTKAVVKFTYEPRLEDELGLTKGDFVYVVEKSTDGWWKGEAPNGG VGWFPSNYVEEVEASTNGNQGSIENRNPAAAAVPAPIMMQAPPPKLQASRSSFEVVVALYSFDASSSEELSFKKGERLEI VDHPEHDPDWWMARNASGTTGLVPRNYIEVVNDSSSSKASHQDFAPQYSGNGEIPMEQQPWYFGRISRERAEDLLLHGRE GEFLVRDSESNPGDLSISMRGIERNKHFKVQNVDGLLKIGNRTFVDMNALINHYTTSPIFSSPTEKLFLTGPLPK