TP53INP1 Tumor protein p53-inducible nuclear protein 1

• Overview
• Annotations

UniProt Data

Enzyme Annotations (0)

GO Annotations

Cellular component (4)

• GO:0005634 Nucleus
  A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
• GO:0005654 Nucleoplasm
  That part of the nuclear content other than the chromosomes or the nucleolus.
• GO:0005776 Autophagosome
  A double-membrane-bounded compartment that engulfs endogenous cellular material as well as invading microorganisms to target them to the vacuole/lysosome for degradation as part of macroautophagy.
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Molecular function (2)

• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
• GO:0016209 Antioxidant activity
  Inhibition of the reactions brought about by dioxygen (O2) or peroxides. Usually the antioxidant is effective because it can itself be more easily oxidized than the substance protected. The term is often applied to components that can trap free radicals, thereby breaking the chain reaction that normally leads to extensive biological damage.

Biological process (9)

• GO:0006950 Response to stress
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a disturbance in organismal or cellular homeostasis, usually, but not necessarily, exogenous (e.g. temperature, humidity, ionizing radiation).
• GO:0007050 Cell cycle arrest
  A regulatory process that halts progression through the cell cycle during one of the normal phases (G1, S, G2, M).
• GO:0008285 Negative regulation of cell proliferation
  Any process that stops, prevents or reduces the rate or extent of cell proliferation.
• GO:0010508 Positive regulation of autophagy
  Any process that activates, maintains or increases the rate of autophagy. Autophagy is the process in which cells digest parts of their own cytoplasm.
• GO:0030336 Negative regulation of cell migration
  Any process that stops, prevents, or reduces the frequency, rate or extent of cell migration.
• GO:0042981 Regulation of apoptotic process
  Any process that modulates the occurrence or rate of cell death by apoptotic process.
• GO:0045893 Positive regulation of transcription, DNA-templated
  Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
• GO:0048102 Autophagic cell death
  A form of programmed cell death that is accompanied by the formation of autophagosomes. Autophagic cell death is characterized by lack of chromatin condensation and massive vacuolization of the cytoplasm, with little or no uptake by phagocytic cells.
• GO:1901796 Regulation of signal transduction by p53 class mediator
  Any process that modulates the frequency, rate or extent of signal transduction by p53 class mediator.

Protein Sequence

>Q96A56
MFQRLNKMFVGEVSSSSNQEPEFNEKEDDEWILVDFIDTCTGFSAEEEEEEEDISEESPTEHPSVFSCLPASLECLADTS
DSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPGLSEATRGTDELHSPSSPRVE
AQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPCPRQYNY