Genome3D
Homo sapiens

PERP p53 apoptosis effector related to PMP-22

UniProt Data

Accession Q96FX8 [ UniProt ]
Name PERP_HUMAN
Description P53 apoptosis effector related to PMP-22
Species Homo sapiens
Sequence Length193

Enzyme Annotations (0)

    GO Annotations

    Cellular component (1)

    None predicted

    Molecular function (1)

    None predicted

    Biological process (4)

    • GO:0042981 Regulation of apoptotic process
      Any process that modulates the occurrence or rate of cell death by apoptotic process.
    • GO:0045862 Positive regulation of proteolysis
      Any process that activates or increases the frequency, rate or extent of the hydrolysis of a peptide bond or bonds within a protein.
    • GO:0070268 Cornification
      A type of programmed cell death that occurs in the epidermis, morphologically and biochemically distinct from apoptosis. It leads to the formation of corneocytes, i.e. dead keratinocytes containing an amalgam of specific proteins (e.g., keratin, loricrin, SPR and involucrin) and lipids (e.g., fatty acids and ceramides), which are necessary for the function of the cornified skin layer (mechanical resistance, elasticity, water repellence and structural stability).
    • GO:0097202 Activation of cysteine-type endopeptidase activity
      Any process that initiates the activity of the inactive enzyme cysteine-type endopeptidase.

    Protein Sequence

    >Q96FX8
MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAM
LFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAAT
IILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA