Mus musculus

UniProt Data

Accession Q9DB75 [ UniProt ]
Name CDIP1_MOUSE
Description Cell death-inducing p53-target protein 1
Species Mus musculus
Sequence Length208

Enzyme Annotations (0)

    GO Annotations

    Cellular component (3)

    • GO:0005634 Nucleus
      A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    • GO:0098560 Cytoplasmic side of late endosome membrane
      The side (leaflet) of the late endosome membrane that faces the cytoplasm.
    • GO:0098574 Cytoplasmic side of lysosomal membrane
      The side (leaflet) of the lysosomal membrane that faces the cytoplasm.

    Molecular function (1)

    None predicted

    Biological process (3)

    • GO:0006915 Apoptotic process
      A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    • GO:0033209 Tumor necrosis factor-mediated signaling pathway
      A series of molecular signals initiated by the binding of a tumor necrosis factor to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    • GO:0042771 Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
      A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage, and ends when the execution phase of apoptosis is triggered.

    Protein Sequence

    >Q9DB75
    MSNEPPPPYPGGPTAPLLEEKSGAPLTPGRTSPAVMQPPPGMPLPSADIAPPPYEPPGQPVPQPGFVPPHMNADGTYMPA
    GFYPPPGPHPPMGYYPPGPYPPGPYPGPGGHTATVLVPSGAATTVTVLQGEIFEGAPVQTVCPHCQQAITTKISYEIGLM
    NFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYICTYKRLC