Pidd1 p53-induced death domain-containing protein 1
UniProt Data
Accession | Q9ERV7 [ UniProt ] |
Name | PIDD1_MOUSE |
Description | P53-induced death domain-containing protein 1 |
Species | Mus musculus |
Sequence Length | 915 |
Enzyme Annotations (0)
GO Annotations
Cellular component (5)
- GO:0005634 Nucleus
A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent. - GO:0005737 Cytoplasm
All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. - GO:0005737 Cytoplasm
All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. - GO:0005794 Golgi apparatus
A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions. - GO:0005829 Cytosol
The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
Molecular function (1)
None predictedBiological process (7)
- GO:0006919 Activation of cysteine-type endopeptidase activity involved in apoptotic process
Any process that initiates the activity of the inactive enzyme cysteine-type endopeptidase in the context of an apoptotic process. - GO:0006974 Cellular response to DNA damage stimulus
Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism. - GO:0006977 DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
A cascade of processes induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage and resulting in the stopping or reduction in rate of the cell cycle. - GO:0043066 Negative regulation of apoptotic process
Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process. - GO:1902043 Positive regulation of extrinsic apoptotic signaling pathway via death domain receptors
Any process that activates or increases the frequency, rate or extent of extrinsic apoptotic signaling pathway via death domain receptors. - GO:2001235 Positive regulation of apoptotic signaling pathway
Any process that activates or increases the frequency, rate or extent of apoptotic signaling pathway. - GO:2001238 Positive regulation of extrinsic apoptotic signaling pathway
Any process that activates or increases the frequency, rate or extent of extrinsic apoptotic signaling pathway.
Protein Sequence
>Q9ERV7 MAAVLEGQEPEETAAAAEDAATSTLEAVDAGPGAPFLPAGNQLNLDLRPGGCHRLQYLCSQQPPQLLQVEFLRLSTHEDP QLLDDTLAKVPWSLLRLRSLVLKGGQSRGALGACLHGTLTTLPAGLSDLACLAHLDLSFNRLETLPTCVPELHGLDALLL SHNHLSELPEALGALPALTFLTVTHNRLERLPLTLGSLSTLQRLDLSENLLDTIPSEIGNLRSLSELNLASNRLQSLPAS LAGLRSLRLLVLHSNLLTSVPTGLVHLPLITRLDLRDNRLRDLPAELLDAPFVRLQGNPLGEASPAPPSPPDISQVPEMP RLLLTSDLDSFLVTPHGCSVTLACGVRLQFPAGATTTPVTIHYRLWLPEPGLVSLGPHDFLLSSVLELQPHGVAFQQDVS LWLLFVPPRVRRCREVVVRTRSNNTWNDLETQLEEEAPKRLWARCQVPHFSWFLVVLRPVSNTCLLPPEGALLCSSGHPG VRVTFPPGVTEEPRQVSMQVVHMAGLELRTLLEESEASVSPLLCLSQSGPPSFLQPVTVQLPLPPGVTGFSLDRSHLHLL YRTPLTTTWDDITTQVALEFTHLYARFQVTHFSWYWLWYTTKTCVGGLARKAWERLRLHRVNLIALQRRRDPEQVLLQCL PRNKVDATLSRLLVRYRGPEPSETVEMFEGEKFFAAFERGIDVDADRPDCVDGRICFVFYSHLKNVKEVYITTALDREAQ DVRGQVSFYRGSLPVEVPAEAEAARQRKGTDALWMATLPIKLPRLRGAQGSGQGTDFSLMPLNLGDAETGFLTQSNLLSV ASRLGPDWPAVALHLGMPYHKLQRIRHEFRDDLDGQVRHMLFSWAERQTGQPGAVGHLVQALEQSDRRDVAEEVRAILEL GRHKYQDSIRRTGLAPEDSTLPGTSASQTPESAQA