Genome3D
Drosophila melanogaster

vtd Verthandi, isoform B

UniProt Data

Accession A0A021WW32 [ UniProt ]
Name A0A021WW32_DROME
Description Verthandi, isoform B
Species Drosophila melanogaster
Sequence Length633

Enzyme Annotations (0)

    GO Annotations

    Cellular component (7)

    • GO:0000775 Chromosome, centromeric region
      The region of a chromosome that includes the centromeric DNA and associated proteins. In monocentric chromosomes, this region corresponds to a single area of the chromosome, whereas in holocentric chromosomes, it is evenly distributed along the chromosome.
    • GO:0000795 Synaptonemal complex
      A proteinaceous scaffold found between homologous chromosomes during meiosis. It consists of 2 lateral elements and a central element, all running parallel to each other. Transverse filaments connect the lateral elements to the central element.
    • GO:0005634 Nucleus
      A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    • GO:0005705 Polytene chromosome interband
      A stretch of less tightly packed chromatin along the polytene chromosome, found between bands.
    • GO:0005721 Pericentric heterochromatin
      Heterochromatin that is located adjacent to the CENP-A rich centromere 'central core' and characterized by the modified histone H3K9me3.
    • GO:0008278 Cohesin complex
      A protein complex that is required for sister chromatid cohesion in eukaryotes. The cohesin complex forms a molecular ring complex, and is composed of structural maintenance of chromosomes (SMC) and kleisin proteins. For example, in yeast, the complex is composed of the SMC proteins Smc1p and Smc3p, and the kleisin protein Scc1p. In vertebrates, the complex is composed of the SMC1 (SMC1A or SMC1B) and SMC3 heterodimer attached via their hinge domains to a kleisin (RAD21, REC8 or RAD21L) which links them, and one STAG protein (STAG1, STAG2 or STAG3).
    • GO:0008278 Cohesin complex
      A protein complex that is required for sister chromatid cohesion in eukaryotes. The cohesin complex forms a molecular ring complex, and is composed of structural maintenance of chromosomes (SMC) and kleisin proteins. For example, in yeast, the complex is composed of the SMC proteins Smc1p and Smc3p, and the kleisin protein Scc1p. In vertebrates, the complex is composed of the SMC1 (SMC1A or SMC1B) and SMC3 heterodimer attached via their hinge domains to a kleisin (RAD21, REC8 or RAD21L) which links them, and one STAG protein (STAG1, STAG2 or STAG3).

    Molecular function (1)

    None predicted

    Biological process (6)

    • GO:0000278 Mitotic cell cycle
      Progression through the phases of the mitotic cell cycle, the most common eukaryotic cell cycle, which canonically comprises four successive phases called G1, S, G2, and M and includes replication of the genome and the subsequent segregation of chromosomes into daughter cells. In some variant cell cycles nuclear replication or nuclear division may not be followed by cell division, or G1 and G2 phases may be absent.
    • GO:0007064 Mitotic sister chromatid cohesion
      The cell cycle process in which the sister chromatids of a replicated chromosome are joined along the entire length of the chromosome, from their formation in S phase through metaphase during a mitotic cell cycle. This cohesion cycle is critical for high fidelity chromosome transmission.
    • GO:0007064 Mitotic sister chromatid cohesion
      The cell cycle process in which the sister chromatids of a replicated chromosome are joined along the entire length of the chromosome, from their formation in S phase through metaphase during a mitotic cell cycle. This cohesion cycle is critical for high fidelity chromosome transmission.
    • GO:0010628 Positive regulation of gene expression
      Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA (for protein-coding genes) and the translation of that mRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    • GO:0016322 Neuron remodeling
      The developmentally regulated remodeling of neuronal projections such as pruning to eliminate the extra dendrites and axons projections set up in early stages of nervous system development.
    • GO:0070193 Synaptonemal complex organization
      A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a synaptonemal complex. A synaptonemal complex is a proteinaceous scaffold formed between homologous chromosomes during meiosis.

    Protein Sequence

    >A0A021WW32
MFYEHIILAKKGPLARIWLAAHWDKKITKAHVFETNIEKSVEGILQPKVKLALRTSGHLLLGVVRIYSRKAKYLLADCNE
AFVKIKMAFRPGMVDLPEGHREANVNAITLPEVFHDFDTALPELNDIDIEAQFSINQSRADEITMREDYGSLSLSLQDDG
FGDIGFEAETPEIIRCSIPSNINDKIFDNDVLENIESLDPHSLDAHADMPGSRLDGDGFGDSFGQPALFEDDLFGDPSQP
VEQITKESTTVLNADDSDEDAIDNIHNVPSPATSLVNSIEDEKEENNLNGHASVSENVPMNEITLVQNEDEGFALAPLDV
SMYKGVTKAKRKRKLIIDEIKNISGEEMKAQLADTSDILTTLDLAPPTKRLMYWKETGGVEKLFSLPSRSIPARALFGNY
NRQLFSHSTFFEDFSSVVPMEILALEFYTKENENALIIFNKKGRKRKNDNMSNLFLDHVPDSVVQSLEAPEVLRANHKSL
GVSTVSVEIVSKEQESISCQNELTFFDNMRSPDLLSLNEMEQFSSINELPLTPRNMNHEMGDDFNQGDSTPAGLDHGHAT
PQHGNIGEMDHDSVIPTKKTAVILNESVGTSVLSDNGVSKRTNNILKGWDNYEIPSFVGQGIRHAGHCYQQYH