Genome3D
Drosophila melanogaster

A0A0B4JCT2 Uncharacterized protein, isoform B

UniProt Data

Accession A0A0B4JCT2 [ UniProt ]
Name A0A0B4JCT2_DROME
Description Uncharacterized protein, isoform B
Species Drosophila melanogaster
Sequence Length298

Enzyme Annotations (0)

    GO Annotations

    Cellular component (3)

    • GO:0005576 Extracellular region
      The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    • GO:0005615 Extracellular space
      That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    • GO:0005615 Extracellular space
      That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

    Molecular function (1)

    None predicted

    Biological process (4)

    • GO:0008104 Protein localization
      Any process in which a protein is transported to, or maintained in, a specific location.
    • GO:0032504 Multicellular organism reproduction
      The biological process in which new individuals are produced by one or two multicellular organisms. The new individuals inherit some proportion of their genetic material from the parent or parents.
    • GO:0046008 Regulation of female receptivity, post-mating
      Any process that modulates the receptiveness of a female to male advances subsequent to mating.
    • GO:0046692 Sperm competition
      Any process that contributes to the success of sperm fertilization in multiply-mated females.

    Protein Sequence

    >A0A0B4JCT2
MLDTKWPPLLLLLMLLGQQLQAFDYCDPTLCPGPERHIACNNFGALADICSPDAHIVRITTARRTMILNELNEYRDRIAR
GDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNVAQVVAEGGWQGDPLPPSSPSDPPNPEAPIPVE
YHTEDEVIKATLEQMFAEYKECSMRDIIAFSPPNNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLS
SVHQYMTCNFVRTNDVNAPVYQSGDRPATECRSGRNPVFINLCSVNEIYDSSNLAGLF