Mmp1 Matrix metalloproteinase 1, isoform E

• Overview
• Annotations

UniProt Data

Enzyme Annotations (1)

• EC:3.4.24.- Metalloendopeptidases.
  

GO Annotations

Cellular component (1)

Molecular function (1)

Biological process (19)

• GO:0002168 Instar larval development
  The process whose specific outcome is the progression of the larva over time, from its formation to the mature structure. This begins with the newly hatched first-instar larva, through its maturation to the end of the last larval stage. An example of this process is found in Drosophila melanogaster.
• GO:0007155 Cell adhesion
  The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
• GO:0007419 Ventral cord development
  The process whose specific outcome is the progression of the ventral cord over time, from its formation to the mature structure. The ventral cord is one of the distinguishing traits of the central nervous system of all arthropods (such as insects, crustaceans and arachnids) as well as many other invertebrates, such as the annelid worms.
• GO:0007424 Open tracheal system development
  The process whose specific outcome is the progression of an open tracheal system over time, from its formation to the mature structure. An open tracheal system is a respiratory system, a branched network of epithelial tubes that supplies oxygen to target tissues via spiracles. An example of this is found in Drosophila melanogaster.
• GO:0007505 Adult fat body development
  The process whose specific outcome is the progression of the adult fat body over time, from its formation to the mature structure. Larval fat body cells that remain at eclosion degenerate in the first 2 to 4 days of adult life, leaving behind the smaller cells of the adult fat body.
• GO:0007561 Imaginal disc eversion
  The eversion (turning inside out) of imaginal discs from their peripodial sacs, resulting in movement of the epithelium to the outside of the larval epidermis.
• GO:0007591 Molting cycle, chitin-based cuticle
  The periodic shedding of part or all of a chitin-based cuticle, which is then replaced by a new cuticle. An example of this is found in Drosophila melanogaster.
• GO:0030198 Extracellular matrix organization
  A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
• GO:0034769 Basement membrane disassembly
  The controlled breakdown of the basement membrane in the context of a normal process such as imaginal disc eversion.
• GO:0035001 Dorsal trunk growth, open tracheal system
  Growth of epithelial tubes that originate from pits in an open tracheal system and grow towards each other to meet and form a continuous open tube called the dorsal trunk. The dorsal trunk extends from the anterior spiracle to the posterior spiracle of the larva and forms the main airway of the insect tracheal system.
• GO:0035071 Salivary gland cell autophagic cell death
  The stage-specific programmed cell death of salivary gland cells during salivary gland histolysis.
• GO:0035159 Regulation of tube length, open tracheal system
  Ensuring that a tube in an open tracheal system is of the correct length.
• GO:0042060 Wound healing
  The series of events that restore integrity to a damaged tissue, following an injury.
• GO:0042246 Tissue regeneration
  The regrowth of lost or destroyed tissues.
• GO:0042246 Tissue regeneration
  The regrowth of lost or destroyed tissues.
• GO:0045216 Cell-cell junction organization
  A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a cell-cell junction. A cell-cell junction is a specialized region of connection between two cells.
• GO:0048102 Autophagic cell death
  A form of programmed cell death that is accompanied by the formation of autophagosomes. Autophagic cell death is characterized by lack of chromatin condensation and massive vacuolization of the cytoplasm, with little or no uptake by phagocytic cells.
• GO:0071711 Basement membrane organization
  A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of the basement membrane.
• GO:0097156 Fasciculation of motor neuron axon
  The collection of motor neuron axons into a bundle of rods, known as a fascicle.

Protein Sequence

>A0A0B4JCU7
MTNCQSSVFIVVGTLFSIMAAAQSAPVSTTTQAEIYLSQFGYLPASARNPASSGLHDQRTWVSAIEEFQSFAGLNITGEL
DAETMKLMSLPRCGVRDRVGTGDSRSKRYALQGSRWRVKNLTYKISKYPKRLKRVDVDAEIGRAFAVWSEDTDLTFTRKT
SGPVHIEIKFVESEHGDGDAFDGQGGTLAHAFFPVFGGDAHFDDAELWTIGSPRGTNLFQVAAHEFGHSLGLSHSDQSSA
LMAPFYRGFEPVFKLDEDDKAAIQSLYGRKTNQLRPTNVYPATTQRPYSPPKVPLDDSICKDSKVDTLFNSAQGETYAFK
GDKYYKLTTDSVEEGYPQLISKGWPGLPGNIDAAFTYKNGKTYFFKGTQYWRYQGRQMDGVYPKEISEGFTGIPDHLDAA
MVWGGNGKIYFFKGSKFWRFDPAKRPPVKASYPKPISNWEGVPNNLDAALKYTNGYTYFFKGDKYYRFHDARFAVDSATP
PFPRPTAHWWFGCKNTPSSTGNIVEGSDNEFEQHSMIPHADDGNGDDFDAGFKRRGYKNKNN