Genome3D
Mus musculus

Ube2ql1 Ubiquitin-conjugating enzyme E2Q-like protein 1

UniProt Data

Accession A0PJN4 [ UniProt ]
Name U2QL1_MOUSE
Description Ubiquitin-conjugating enzyme E2Q-like protein 1
Species Mus musculus
Sequence Length161

Enzyme Annotations (1)

  • EC:2.3.2.23 E2 ubiquitin-conjugating enzyme.
    S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L- cysteine.

GO Annotations

Cellular component (3)

  • GO:0005634 Nucleus
    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
  • GO:0005634 Nucleus
    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
  • GO:0005886 Plasma membrane
    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Molecular function (1)

None predicted

Biological process (1)

None predicted

Protein Sequence

>A0PJN4
MKELQDIARLSDRFISVELVNENLFDWNVKLHQVDKDSVLWQDMKETNTEFILLNLTFPDNFPFSPPFMRVLSPRLENGY
VLDGGAICMELLTPRGWSSAYTVEAVMRQFAASLVKGQGRICRKAGKSKKSFSRKEAEATFKSLVKTHEKYGWVTPPVSD
G