Genome3D
Schizosaccharomyces pombe 972h-

eaf1 Ell1-associated factor 1

UniProt Data

Accession A0ZWU1 [ UniProt ]
Name EAF1_SCHPO
Description Ell1-associated factor 1
Species Schizosaccharomyces pombe 972h-
Sequence Length251

Enzyme Annotations (0)

    GO Annotations

    Cellular component (1)

    None predicted

    Molecular function (1)

    None predicted

    Biological process (3)

    • GO:0006368 Transcription elongation from RNA polymerase II promoter
      The extension of an RNA molecule after transcription initiation and promoter clearance at an RNA polymerase II promoter by the addition of ribonucleotides catalyzed by RNA polymerase II.
    • GO:0032968 Positive regulation of transcription elongation from RNA polymerase II promoter
      Any process that activates or increases the frequency, rate or extent of transcription elongation, the extension of an RNA molecule after transcription initiation and promoter clearance by the addition of ribonucleotides, catalyzed by RNA polymerase II.
    • GO:0045944 Positive regulation of transcription from RNA polymerase II promoter
      Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.

    Protein Sequence

    >A0ZWU1
MNSLQKGSYKVIPGSSFSKNSNGLLSIKYNFIPESVDPSRRGVLEKAQEAYRLRLPSTFDDDRPHIFEGSCQRARNVDCV
LIFNAKTKTFTLEHIDEIARLNALRNPKVSKTVPSNAITQSDNSQISESKSTSQSAVTTNSTRRKEKELEASKDGKIKPS
SSNTRYPAISSKGPITTDTNDEPDMEVMELDDFAKELELGFDQEFNSIDDPSTVSQTASKPISLRGLSSQERDYASSAQA
EGISSASEDED