Genome3D
Mus musculus

Isx Intestine-specific homeobox

UniProt Data

Accession A1A546 [ UniProt ]
Name ISX_MOUSE
Description Intestine-specific homeobox
Species Mus musculus
Sequence Length240

Enzyme Annotations (0)

    GO Annotations

    Cellular component (1)

    None predicted

    Molecular function (2)

    • GO:0001227 Transcriptional repressor activity, RNA polymerase II transcription regulatory region sequence-specific binding
      Interacting selectively and non-covalently with a sequence of DNA that is in the regulatory region for RNA polymerase II (RNAP II) in order to stop, prevent, or reduce the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    • GO:0043565 Sequence-specific DNA binding
      Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.

    Biological process (3)

    • GO:0006357 Regulation of transcription from RNA polymerase II promoter
      Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    • GO:1901738 Regulation of vitamin A metabolic process
      Any process that modulates the frequency, rate or extent of vitamin A metabolic process.
    • GO:1904479 Negative regulation of intestinal absorption
      Any process that stops, prevents or reduces the frequency, rate or extent of intestinal absorption.

    Protein Sequence

    >A1A546
MAGPTIHRDMEKSSGYCEAPENLGLSFSIEAILKKPTERRSLPRPQSICKEDSRQTTIPGSKLERPPQDQPQEEKKNKRR
VRTTFTTEQLQELEKLFHFTHYPDIHVRSQLASRINLPEARVQIWFQNQRAKWRKQEKSGNLSAPQQPGEAGLALPSNMD
VSGPVLTPTAMTTLVPPTECCLLSQTQLPSSWFPTQIPLVPWHPWDLQPLPGPLTQHPCVPTFMFPPLHPKWGSICATST