Pkd2l1 Polycystic kidney disease 2-like 1 protein

• Overview
• Annotations

UniProt Data

Enzyme Annotations (0)

GO Annotations

Cellular component (11)

• GO:0005783 Endoplasmic reticulum
  The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
• GO:0005886 Plasma membrane
  The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
• GO:0005886 Plasma membrane
  The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
• GO:0016020 Membrane
  A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
• GO:0034703 Cation channel complex
  An ion channel complex through which cations pass.
• GO:0034704 Calcium channel complex
  An ion channel complex through which calcium ions pass.
• GO:0034704 Calcium channel complex
  An ion channel complex through which calcium ions pass.
• GO:0043231 Intracellular membrane-bounded organelle
  Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
• GO:0043235 Receptor complex
  Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
• GO:0097730 Non-motile cilium
  A cilium which may have a variable array of axonemal microtubules but does not contain molecular motors.
• GO:0097730 Non-motile cilium
  A cilium which may have a variable array of axonemal microtubules but does not contain molecular motors.

Molecular function (14)

• GO:0005227 Calcium activated cation channel activity
  Enables the calcium concentration-regulatable energy-independent passage of cations across a lipid bilayer down a concentration gradient.
• GO:0005261 Cation channel activity
  Enables the energy-independent passage of cations across a lipid bilayer down a concentration gradient.
• GO:0005261 Cation channel activity
  Enables the energy-independent passage of cations across a lipid bilayer down a concentration gradient.
• GO:0005262 Calcium channel activity
  Enables the facilitated diffusion of a calcium ion (by an energy-independent process) involving passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism.
• GO:0005262 Calcium channel activity
  Enables the facilitated diffusion of a calcium ion (by an energy-independent process) involving passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism.
• GO:0005272 Sodium channel activity
  Enables the facilitated diffusion of a sodium ion (by an energy-independent process) involving passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism.
• GO:0005509 Calcium ion binding
  Interacting selectively and non-covalently with calcium ions (Ca2+).
• GO:0005509 Calcium ion binding
  Interacting selectively and non-covalently with calcium ions (Ca2+).
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
• GO:0008092 Cytoskeletal protein binding
  Interacting selectively and non-covalently with any protein component of any cytoskeleton (actin, microtubule, or intermediate filament cytoskeleton).
• GO:0015269 Calcium-activated potassium channel activity
  Enables the calcium concentration-regulatable energy-independent passage of potassium ions across a lipid bilayer down a concentration gradient.
• GO:0042802 Identical protein binding
  Interacting selectively and non-covalently with an identical protein or proteins.
• GO:0051371 Muscle alpha-actinin binding
  Interacting selectively and non-covalently with muscle isoforms of actinin. Muscle alpha-actinin isoforms are found in skeletal and cardiac muscle and are localized to the Z-disc.
• GO:0051393 Alpha-actinin binding
  Interacting selectively and non-covalently with alpha-actinin, one of a family of proteins that cross-link F-actin as antiparallel homodimers. Alpha-actinin has a molecular mass of 93-103 KDa; at the N-terminus there are two calponin homology domains, at the C-terminus there are two EF-hands. These two domains are connected by the rod domain. This domain is formed by triple-helical spectrin repeats.

Biological process (9)

• GO:0001581 Detection of chemical stimulus involved in sensory perception of sour taste
  The series of events required for a sour taste stimulus to be received and converted to a molecular signal.
• GO:0006812 Cation transport
  The directed movement of cations, atoms or small molecules with a net positive charge, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
• GO:0007224 Smoothened signaling pathway
  A series of molecular signals generated as a consequence of activation of the transmembrane protein Smoothened.
• GO:0035725 Sodium ion transmembrane transport
  A process in which a sodium ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
• GO:0050915 Sensory perception of sour taste
  The series of events required to receive a sour taste stimulus, convert it to a molecular signal, and recognize and characterize the signal. This is a neurological process.
• GO:0070207 Protein homotrimerization
  The formation of a protein homotrimer, a macromolecular structure consisting of three noncovalently associated identical subunits.
• GO:0070207 Protein homotrimerization
  The formation of a protein homotrimer, a macromolecular structure consisting of three noncovalently associated identical subunits.
• GO:0071468 Cellular response to acidic pH
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a pH stimulus with pH < 7. pH is a measure of the acidity or basicity of an aqueous solution.
• GO:0071805 Potassium ion transmembrane transport
  A process in which a potassium ion is transported from one side of a membrane to the other.

Protein Sequence

>A2A259
MNSMESPKNQELQTLGNRAWDNPAYSDPPSPNRTLRICTVSSVALPETQPKKPEVRCQEKTQRTLVSSCCLHICRSIRGL
WGTTLTENTAENRELYVKTTLRELVVYIVFLVDICLLTYGMTSSSAYYYTKVMSELFLHTPSDSGVSFQTISSMSDFWDF
AQGPLLDSLYWTKWYNNQSLGRGSHSFIYYENLLLGAPRLRQLRVRNDSCVVHEDFREDILNCYDVYSPDKEDQLPFGPQ
NGTAWTYHSQNELGGSSHWGRLTSYSGGGYYLDLPGSRQASAEALQGLQEGLWLDRGTRVVFIDFSVYNANINLFCILRL
VVEFPATGGTIPSWQIRTVKLIRYVNNWDFFIVGCEVVFCVFIFYYVVEEILEIHLHRLRYLSSVWNILDLVVILLSIVA
VGFHIFRTLEVNRLMGKLLQQPDTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGF
AIMFFIVFFAYAQLGYLLFGTQVENFSTFVKCIFTQFRIILGDFDYNAIDNANRILGPVYFVTYVFFVFFVLLNMFLAII
NDTYSEVKEELAGQKDQLQLSDFLKQSYNKTLLRLRLRKERVSDVQKVLKGGEPEIQFEDFTSTLRELGHEEHEITAAFT
RFDQDGDHILDEEEQEQMRQGLEEERVTLNAEIENLGRSVGHSPPGELGAEAARGQSWVSGEEFDMLTRRVLQLQCVLEG
VVSQIDAVGSKLKMLERKGELAPSPGMGEPAVWENLYNPS