Sh3pxd2b SH3 and PX domain-containing protein 2B

• Overview
• Annotations

UniProt Data

Enzyme Annotations (0)

GO Annotations

Cellular component (2)

• GO:0002102 Podosome
  An actin-rich adhesion structure characterized by formation upon cell substrate contact and localization at the substrate-attached part of the cell, contain an F-actin-rich core surrounded by a ring structure containing proteins such as vinculin and talin, and have a diameter of 0.5 mm.
• GO:0005737 Cytoplasm
  All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Molecular function (5)

• GO:0010314 Phosphatidylinositol-5-phosphate binding
  Interacting selectively and non-covalently with phosphatidylinositol-5-phosphate, a derivative of phosphatidylinositol in which the inositol ring is phosphorylated at the 5' position.
• GO:0032266 Phosphatidylinositol-3-phosphate binding
  Interacting selectively and non-covalently with phosphatidylinositol-3-phosphate, a derivative of phosphatidylinositol in which the inositol ring is phosphorylated at the 3' position.
• GO:0042169 SH2 domain binding
  Interacting selectively and non-covalently with a SH2 domain (Src homology 2) of a protein, a protein domain of about 100 amino-acid residues and belonging to the alpha + beta domain class.
• GO:0070273 Phosphatidylinositol-4-phosphate binding
  Interacting selectively and non-covalently with phosphatidylinositol-4-phosphate, a derivative of phosphatidylinositol in which the inositol ring is phosphorylated at the 4' position.
• GO:0080025 Phosphatidylinositol-3,5-bisphosphate binding
  Interacting selectively and non-covalently with phosphatidylinositol-3,5-bisphosphate, a derivative of phosphatidylinositol in which the inositol ring is phosphorylated at the 3' and 5' positions.

Biological process (24)

• GO:0001501 Skeletal system development
  The process whose specific outcome is the progression of the skeleton over time, from its formation to the mature structure. The skeleton is the bony framework of the body in vertebrates (endoskeleton) or the hard outer envelope of insects (exoskeleton or dermoskeleton).
• GO:0001501 Skeletal system development
  The process whose specific outcome is the progression of the skeleton over time, from its formation to the mature structure. The skeleton is the bony framework of the body in vertebrates (endoskeleton) or the hard outer envelope of insects (exoskeleton or dermoskeleton).
• GO:0001654 Eye development
  The process whose specific outcome is the progression of the eye over time, from its formation to the mature structure. The eye is the organ of sight.
• GO:0001654 Eye development
  The process whose specific outcome is the progression of the eye over time, from its formation to the mature structure. The eye is the organ of sight.
• GO:0002051 Osteoblast fate commitment
  The commitment of mesenchymal cells to the specific cell fate of an osteoblast. An osteoblast is a bone-forming cell which secretes an extracellular matrix. Hydroxyapatite crystals are then deposited into the matrix to form bone.
• GO:0006801 Superoxide metabolic process
  The chemical reactions and pathways involving superoxide, the superoxide anion O2- (superoxide free radical), or any compound containing this species.
• GO:0006801 Superoxide metabolic process
  The chemical reactions and pathways involving superoxide, the superoxide anion O2- (superoxide free radical), or any compound containing this species.
• GO:0007507 Heart development
  The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
• GO:0007507 Heart development
  The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
• GO:0010628 Positive regulation of gene expression
  Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA (for protein-coding genes) and the translation of that mRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
• GO:0022617 Extracellular matrix disassembly
  A process that results in the breakdown of the extracellular matrix.
• GO:0040018 Positive regulation of multicellular organism growth
  Any process that activates or increases the frequency, rate or extent of growth of an organism to reach its usual body size.
• GO:0045600 Positive regulation of fat cell differentiation
  Any process that activates or increases the frequency, rate or extent of adipocyte differentiation.
• GO:0048705 Skeletal system morphogenesis
  The process in which the anatomical structures of the skeleton are generated and organized.
• GO:0051496 Positive regulation of stress fiber assembly
  Any process that activates or increases the frequency, rate or extent of the assembly of a stress fiber, a bundle of microfilaments and other proteins found in fibroblasts.
• GO:0060348 Bone development
  The process whose specific outcome is the progression of bone over time, from its formation to the mature structure. Bone is the hard skeletal connective tissue consisting of both mineral and cellular components.
• GO:0060348 Bone development
  The process whose specific outcome is the progression of bone over time, from its formation to the mature structure. Bone is the hard skeletal connective tissue consisting of both mineral and cellular components.
• GO:0060378 Regulation of brood size
  Any process that modulates brood size. Brood size is the number of progeny that survive embryogenesis and are cared for at one time.
• GO:0060612 Adipose tissue development
  The process whose specific outcome is the progression of adipose tissue over time, from its formation to the mature structure. Adipose tissue is specialized tissue that is used to store fat.
• GO:0071800 Podosome assembly
  The aggregation, arrangement and bonding together of a set of components to form a podosome, an actin-rich adhesion structure characterized by formation upon cell substrate contact and localization at the substrate-attached part of the cell.
• GO:0072657 Protein localization to membrane
  A process in which a protein is transported to, or maintained in, a specific location in a membrane.
• GO:0072657 Protein localization to membrane
  A process in which a protein is transported to, or maintained in, a specific location in a membrane.
• GO:1904179 Positive regulation of adipose tissue development
  Any process that activates or increases the frequency, rate or extent of adipose tissue development.
• GO:1904888 Cranial skeletal system development
  The process whose specific outcome is the progression of a cranial skeletal system over time, from its formation to the mature structure. The cranial skeletal system is the skeletal subdivision of the head, and includes the skull (cranium plus mandible), pharyngeal and/or hyoid apparatus.

Protein Sequence

>A2AAY5
MPPRRSIVEVKVLDVQKRRVPNKHYVYIIRVTWSSGATEAIYRRYSKFFDLQMQMLDKFPMEGGQKDPKQRIIPFLPGKI
LFRRSHIRDVAVKRLIPIDEYCKALIQLPPYISQCDEVLQFFETRPEDLNPPKEEHIGKKKSGNDPTSVDPMVLEQYVVV
ADYQKQESSEISLSVGQVVDIIEKNESGWWFVSTAEEQGWVPATCLEGQDGVQDEFSLQPEEEEKYTVIYPYTARDQDEM
NLERGAVVEVVQKNLEGWWKIRYQGKEGWAPASYLKKNSGEPLPPKLGPSSPAHSGALDLDGVSRHQNAMGREKELLNNQ
RDGRFEGRLVPDGDVKQRSPKMRQRPPPRRDMTIPRGLNLPKPPIPPQVEEEYYTIAEFQTTIPDGISFQAGLKVEVIEK
SLSGWWYIQMEDKEGWAPATFIDKYKKTSSASRPNFLAPLPHEMTQLRLGDAAATENNTGPEAVGPSRPLPEAPHGAVDS
GMLWSKDWKGGKEAPRKASSDLSASTGYEEISDPTQEEKPSLPPRKESIIKSEEELLERERQKMEPLRGSSPKPPGMILP
MIPAKHAPLARDSRKPEPKLDKSKFPLRNDMGLECGHKVLAKEVKKPNLRPISRSKAELSEEKVDPTSQNLFMKSRPQVR
PKPTPSPKTEPAQSEDHVDIYNLRSKLRPAKSQEKALLDGESHHAAGSHDTALSRSFLPGEGPGHGQDRSGRQDGLSPKE
TPCRAPPRPAKTTDPGPKNVPVPVQEATLQQRPVVPPRRPPPPKKTSSSPLSCRPLPEVRGAQREESRVAPAAGRALLVP
PKAKPFLSNSSVGQDDMRGKGGLGPRVTGKVGETREKAASFLNADGPKDSLYVAVANFEGDEDTSSFQEGTVFEVREKNS
SGWWFCQVLSGAPSWEGWIPSNYLRKKP