Genome3D
Saccharomyces cerevisiae S288C

STE2 Pheromone alpha factor receptor

UniProt Data

Accession D6VTK4 [ UniProt ]
Name STE2_YEAST
Description Pheromone alpha factor receptor
Species Saccharomyces cerevisiae S288C
Sequence Length431

Enzyme Annotations (0)

    GO Annotations

    Cellular component (1)

    None predicted

    Molecular function (4)

    • GO:0004934 Mating-type alpha-factor pheromone receptor activity
      Combining with the mating-type alpha-factor pheromone to initiate a change in cell activity.
    • GO:0004934 Mating-type alpha-factor pheromone receptor activity
      Combining with the mating-type alpha-factor pheromone to initiate a change in cell activity.
    • GO:0004934 Mating-type alpha-factor pheromone receptor activity
      Combining with the mating-type alpha-factor pheromone to initiate a change in cell activity.
    • GO:0004934 Mating-type alpha-factor pheromone receptor activity
      Combining with the mating-type alpha-factor pheromone to initiate a change in cell activity.

    Biological process (5)

    • GO:0000750 Pheromone-dependent signal transduction involved in conjugation with cellular fusion
      A signal transduction process resulting in the relay, amplification or dampening of a signal generated in response to pheromone exposure in organisms that undergo conjugation with cellular fusion. An example of this process is found in Saccharomyces cerevisiae.
    • GO:0000755 Cytogamy
      During conjugation with cellular fusion, the process resulting in creating a single cell from complementary mating types. The localized remodeling and dissolution of external protective structures allow the fusion of the plasma membranes and cytoplasmic mixing. An example of this process is found in Saccharomyces cerevisiae.
    • GO:0000755 Cytogamy
      During conjugation with cellular fusion, the process resulting in creating a single cell from complementary mating types. The localized remodeling and dissolution of external protective structures allow the fusion of the plasma membranes and cytoplasmic mixing. An example of this process is found in Saccharomyces cerevisiae.
    • GO:0030031 Cell projection assembly
      Formation of a prolongation or process extending from a cell, e.g. a flagellum or axon.
    • GO:0051260 Protein homooligomerization
      The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of identical component monomers. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.

    Protein Sequence

    >D6VTK4
MSDAAPSLSNLFYDPTYNPGQSTINYTSIYGNGSTITFDELQGLVNSTVTQAIMFGVRCGAAALTLIVMWMTSRSRKTPI
FIINQVSLFLIILHSALYFKYLLSNYSSVTYALTGFPQFISRGDVHVYGATNIIQVLLVASIETSLVFQIKVIFTGDNFK
RIGLMLTSISFTLGIATVTMYFVSAVKGMIVTYNDVSATQDKYFNASTILLASSINFMSFVLVVKLILAIRSRRFLGLKQ
FDSFHILLIMSCQSLLVPSIIFILAYSLKPNQGTDVLTTVATLLAVLSLPLSSMWATAANNASKTNTITSDFTTSTDRFY
PGTLSSFQTDSINNDAKSSLRSRLYDLYPRRKETTSDKHSERTFVSETADDIEKNQFYQLPTPTSSKNTRIGPFADASYK
EGEVEPVDMYTPDTAADEEARKFWTEDNNNL