csk-1 Tyrosine-protein kinase csk-1

• Overview
• Annotations

UniProt Data

Enzyme Annotations (1)

• EC:2.7.10.2 Non-specific protein-tyrosine kinase.
  ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

GO Annotations

Cellular component (2)

• GO:0005886 Plasma membrane
  The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
• GO:0005911 Cell-cell junction
  A cell junction that forms a connection between two or more cells in a multicellular organism; excludes direct cytoplasmic junctions such as ring canals.

Molecular function (1)

Biological process (5)

• GO:0002119 Nematode larval development
  The process whose specific outcome is the progression of the nematode larva over time, from its formation to the mature structure. Nematode larval development begins with the newly hatched first-stage larva (L1) and ends with the end of the last larval stage (for example the fourth larval stage (L4) in C. elegans). Each stage of nematode larval development is characterized by proliferation of specific cell lineages and an increase in body size without alteration of the basic body plan. Nematode larval stages are separated by molts in which each stage-specific exoskeleton, or cuticle, is shed and replaced anew.
• GO:0009792 Embryo development ending in birth or egg hatching
  The process whose specific outcome is the progression of an embryo over time, from zygote formation until the end of the embryonic life stage. The end of the embryonic life stage is organism-specific and may be somewhat arbitrary; for mammals it is usually considered to be birth, for insects the hatching of the first instar larva from the eggshell.
• GO:0030536 Larval feeding behavior
  Feeding behavior in a larval (immature) organism.
• GO:0043050 Pharyngeal pumping
  The contraction and relaxation movements of the pharyngeal muscle that mediate feeding in nematodes.
• GO:0048747 Muscle fiber development
  The process whose specific outcome is the progression of the muscle fiber over time, from its formation to the mature structure. In skeletal muscle, fibers are formed by the maturation of myotubes. They can be classed as slow, intermediate/fast or fast.

Protein Sequence

>G5ECJ6
MSNGNSYNHHHQFPMSIPISCSSHSIQSQSRMNTLNANRDLLSPGNDVIVTRTVSPSFYSHGMPARDNVFRKDDHVRILG
NTTDPAWYRARNANQEEGLVHADCVVRINGQAYDNGIVRMRASGCDVAPGAASTTSSTSSHHSTAANHQPWFHSMISREN
TEKLLRGKPDGTFLVRESTNFPGDFTLCMSFHGKVEHYRIEQTSGGQLTCDKEEYFSNLTQLVSHYKRDADGLCHRLVTP
IICETATFSSNGSSSFGSSSTVDLEDRTSVFRHAGLVISSNDIDVGDTIGHGEFGDVRLGTYKNRKVALKVSKRHGNGML
DSLLDEAKFMVGLSHPNLVTLVGVVLDDVNVYMITEYMANGNLIDLLRSRGRHALERRQLMMFAMDICQGMCYLESKQIV
HRDLAARNVLLDDDLVAKVSDFGLAKKANSQSHDSASGKFPIKWTAPEALRHSQFTTKSDVWSFGILLWEIFSFGRVPYP
RIPIQDVVRYIEKGYRMEAPEGCPPEIFKVMNETWALSAQDRPSFGQVLQRLTTIRNTV