Caenorhabditis elegans

UniProt Data

Accession G5EDP9 [ UniProt ]
Name G5EDP9_CAEEL
Description Phosphoinositide 3-kinase adapter subunit
Species Caenorhabditis elegans
Sequence Length522

Enzyme Annotations (0)

    GO Annotations

    Cellular component (1)

    None predicted

    Molecular function (1)

    None predicted

    Biological process (5)

    • GO:0008286 Insulin receptor signaling pathway
      The series of molecular signals generated as a consequence of the insulin receptor binding to insulin.
    • GO:0008286 Insulin receptor signaling pathway
      The series of molecular signals generated as a consequence of the insulin receptor binding to insulin.
    • GO:0008340 Determination of adult lifespan
      The control of viability and duration in the adult phase of the life-cycle.
    • GO:0040024 Dauer larval development
      The process whose specific outcome is the progression of the dauer larva over time, through the facultative diapause of the dauer (enduring) larval stage, with specialized traits adapted for dispersal and long-term survival, with elevated stress resistance and without feeding.
    • GO:0040024 Dauer larval development
      The process whose specific outcome is the progression of the dauer larva over time, through the facultative diapause of the dauer (enduring) larval stage, with specialized traits adapted for dispersal and long-term survival, with elevated stress resistance and without feeding.

    Protein Sequence

    >G5EDP9
    MSTTPGTPHGVTHSLMEQGWYWADADRSAVSKALSDQPDGSFIVRNASTPGDYTLSVKFAAQVKLLRIVVKDGKCGFNTD
    SLTHDSVVRLIEFHRNISLNIFNDALDVRLLYPVSVRRNSQNGKPFFKKGQLQQRMILSAKNDHDWRERLEMENLRAVHL
    AFERGAKLYDSAHQEMERAESLYHALNQSVRDNEIKLGKLNNLLEAETDVVTQIQGSQTTSEMLKGAFANNKTFVEESIR
    RINTELTSSKDKKKTLSGILDEIAMKRSNSKTRLCKLMELRSAVYDKMEPALCSRMAAMLDAGAEMINSEPTKVTQLLVD
    MELKWTPAQYLMCGTSKENAANALIHARYRIAQLDKAVGLKREPQDGIFLIRGSSSHGDKLVLSVLHGERVSHCLIEQNE
    EGWGFEHSNVYLTTISDFVRYYSHFSLETHADAIKTPLRTPAFDAVTSDTSKPLRNGPGQVFTALPISRKYMEKALLTDD
    PTKPPESPEPRPDSWDSPSPDTPSSSDSRLVHPTTLPKSIPE