aap-1 Phosphoinositide 3-kinase adapter subunit
UniProt Data
Accession | G5EDP9 [ UniProt ] |
Name | G5EDP9_CAEEL |
Description | Phosphoinositide 3-kinase adapter subunit |
Species | Caenorhabditis elegans |
Sequence Length | 522 |
Enzyme Annotations (0)
GO Annotations
Cellular component (1)
None predictedMolecular function (1)
None predictedBiological process (5)
- GO:0008286 Insulin receptor signaling pathway
The series of molecular signals generated as a consequence of the insulin receptor binding to insulin. - GO:0008286 Insulin receptor signaling pathway
The series of molecular signals generated as a consequence of the insulin receptor binding to insulin. - GO:0008340 Determination of adult lifespan
The control of viability and duration in the adult phase of the life-cycle. - GO:0040024 Dauer larval development
The process whose specific outcome is the progression of the dauer larva over time, through the facultative diapause of the dauer (enduring) larval stage, with specialized traits adapted for dispersal and long-term survival, with elevated stress resistance and without feeding. - GO:0040024 Dauer larval development
The process whose specific outcome is the progression of the dauer larva over time, through the facultative diapause of the dauer (enduring) larval stage, with specialized traits adapted for dispersal and long-term survival, with elevated stress resistance and without feeding.
Protein Sequence
>G5EDP9 MSTTPGTPHGVTHSLMEQGWYWADADRSAVSKALSDQPDGSFIVRNASTPGDYTLSVKFAAQVKLLRIVVKDGKCGFNTD SLTHDSVVRLIEFHRNISLNIFNDALDVRLLYPVSVRRNSQNGKPFFKKGQLQQRMILSAKNDHDWRERLEMENLRAVHL AFERGAKLYDSAHQEMERAESLYHALNQSVRDNEIKLGKLNNLLEAETDVVTQIQGSQTTSEMLKGAFANNKTFVEESIR RINTELTSSKDKKKTLSGILDEIAMKRSNSKTRLCKLMELRSAVYDKMEPALCSRMAAMLDAGAEMINSEPTKVTQLLVD MELKWTPAQYLMCGTSKENAANALIHARYRIAQLDKAVGLKREPQDGIFLIRGSSSHGDKLVLSVLHGERVSHCLIEQNE EGWGFEHSNVYLTTISDFVRYYSHFSLETHADAIKTPLRTPAFDAVTSDTSKPLRNGPGQVFTALPISRKYMEKALLTDD PTKPPESPEPRPDSWDSPSPDTPSSSDSRLVHPTTLPKSIPE