Dap160 Dynamin associated protein 160, isoform D

• Overview
• Annotations

UniProt Data

Enzyme Annotations (0)

GO Annotations

Cellular component (4)

• GO:0005737 Cytoplasm
  All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
• GO:0005886 Plasma membrane
  The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
• GO:0008021 Synaptic vesicle
  A secretory organelle, typically 50 nm in diameter, of presynaptic nerve terminals; accumulates in high concentrations of neurotransmitters and secretes these into the synaptic cleft by fusion with the 'active zone' of the presynaptic plasma membrane.
• GO:0045179 Apical cortex
  The region that lies just beneath the plasma membrane on the apical edge of a cell.

Molecular function (1)

Biological process (8)

• GO:0002052 Positive regulation of neuroblast proliferation
  Any process that activates or increases the rate of neuroblast proliferation.
• GO:0007269 Neurotransmitter secretion
  The regulated release of neurotransmitter from the presynapse into the synaptic cleft via calcium regualated exocytosis during synaptic transmission.
• GO:0008104 Protein localization
  Any process in which a protein is transported to, or maintained in, a specific location.
• GO:0045746 Negative regulation of Notch signaling pathway
  Any process that stops, prevents, or reduces the frequency, rate or extent of the Notch signaling pathway.
• GO:0045860 Positive regulation of protein kinase activity
  Any process that activates or increases the frequency, rate or extent of protein kinase activity.
• GO:0048488 Synaptic vesicle endocytosis
  Clathrin-mediated endocytosis of presynaptic membrane that recycles synaptic vesicle membrane and its components following synaptic vesicle exocytosis. This process starts with coating of the membrane with adaptor proteins and clathrin prior to invagination and ends when uncoating has finished.
• GO:0048488 Synaptic vesicle endocytosis
  Clathrin-mediated endocytosis of presynaptic membrane that recycles synaptic vesicle membrane and its components following synaptic vesicle exocytosis. This process starts with coating of the membrane with adaptor proteins and clathrin prior to invagination and ends when uncoating has finished.
• GO:0051124 Synaptic growth at neuromuscular junction
  The growth of a synapse at a neuromuscular junction, the site of apposition of a motor end plate and the subneural cleft of the skeletal muscle fiber that it innervates.

Protein Sequence

>M9ND00
MNSAVDAWAVTPRERLKYQEQFRALQPQAGFVTGAQAKGFFLQSQLPPLILGQIWALADTDSDGKMNINEFSIACKLINL
KLRGMDVPKVLPPSLLSSLTGDVPSMTPRGSTSSLSPLDPLKGIVPAVAPVVPVVAPPVAVATVISPPGVSVPSGPTPPT
SNPPSRHTSISERAPSIESVNQGEWAVQAAQKRKYTQVFNANDRTRSGYLTGSQARGVLVQSKLPQVTLAQIWTLSDIDG
DGRLNCDEFILAMFLCEKAMAGEKIPVTLPQEWVPPNLRKIKSRPGSVSGVVSRPGSQPASRHASVSSQSGVGVVDADPT
AGLPGQNKRKENYVKGQAELDRRRKIMEDQQRKEREERERKEREEADKREKARLEAERKQQEELERQLQRQREIEMEKEE
QRKRELEAKEAARKELEKQRQQEWEQARIAEMNAQKEREQERVLKQKAHNTQLNVELSTLNEKIKELSQRICDTRAGVTN
VKTVIDGMRTQRDTSMSEMSQLKARIKEQNAKLLQLTQERAKWEAKSKASGAALGGENAQQEQLNAAFAHKQLIINQIKD
KVENISKEIESKKEDINTNDVQMSELKAELSALITKCEDLYKEYDVQRTSVLELKYNRKNETSVSSAWDTGSSSAWEETG
TTVTDPYAVASNDISALAAPAVDLGGPAPEGFVKYQAVYEFNARNAEEITFVPGDIILVPLEQNAEPGWLAGEINGHTGW
FPESYVEKLEVGEVAPVAAVEAPVDAQVATVADTYNDNINTSSIPAASADLTAAGDVEYYIAAYPYESAEEGDLSFSAGE
MVMVIKKEGEWWTGTIGSRTGMFPSNYVQKADVGTASTAAAEPVESLDQETTLNGNAAYTAAPVEAQEQVYQPLPVQEPS
EQPISSPGVGAEEAHEDLDTEVSQINTQSKTQSSEPAESYSRPMSRTSSMTPGMRAKRSEIAQVIAPYEATSTEQLSLTR
GQLIMIRKKTDSGWWEGELQAKGRRRQIGWFPATYVKVLQGGRNSGRNTPVSGSRIEMTEQILDKVIALYPYKAQNDDEL
SFDKDDIISVLGRDEPEWWRGELNGLSGLFPSNYVGPFVTSEIKPDPGACSRRSKGIQRLWQQWRGCDIDQAAQHGDASN
NKLRGIIQAVHITKRRDGQLMGCAYVRFECNELLAKSMLQENGNQLVGKAVVVDWQPELPKKRFRQWRCW