Pik3r2 Phosphatidylinositol 3-kinase regulatory subunit beta

• Overview
• Annotations

UniProt Data

Enzyme Annotations (0)

GO Annotations

Cellular component (3)

• GO:0005634 Nucleus
  A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
• GO:0005925 Focal adhesion
  Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
• GO:0005942 Phosphatidylinositol 3-kinase complex
  A protein complex capable of phosphatidylinositol 3-kinase activity and containing subunits of any phosphatidylinositol 3-kinase (PI3K) enzyme. These complexes are divided in three classes (called I, II and III) that differ for their presence across taxonomic groups and for the type of their constituents. Catalytic subunits of phosphatidylinositol 3-kinase enzymes are present in all 3 classes; regulatory subunits of phosphatidylinositol 3-kinase enzymes are present in classes I and III; adaptor proteins have been observed in class II complexes and may be present in other classes too.

Molecular function (7)

• GO:0001784 Phosphotyrosine binding
  Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein.
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
• GO:0008134 Transcription factor binding
  Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
• GO:0019903 Protein phosphatase binding
  Interacting selectively and non-covalently with any protein phosphatase.
• GO:0030971 Receptor tyrosine kinase binding
  Interacting selectively and non-covalently with a receptor that possesses protein tyrosine kinase activity.
• GO:0036312 Phosphatidylinositol 3-kinase regulatory subunit binding
  Interacting selectively and non-covalently with a regulatory subunit of phosphatidylinositol 3-kinase. The regulatory subunit associates with the catalytic subunit to regulate both its activity and subcellular location.
• GO:0046982 Protein heterodimerization activity
  Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.

Biological process (16)

• GO:0001678 Cellular glucose homeostasis
  A cellular homeostatic process involved in the maintenance of an internal steady state of glucose within a cell or between a cell and its external environment.
• GO:0008286 Insulin receptor signaling pathway
  The series of molecular signals generated as a consequence of the insulin receptor binding to insulin.
• GO:0010506 Regulation of autophagy
  Any process that modulates the frequency, rate or extent of autophagy. Autophagy is the process in which cells digest parts of their own cytoplasm.
• GO:0010506 Regulation of autophagy
  Any process that modulates the frequency, rate or extent of autophagy. Autophagy is the process in which cells digest parts of their own cytoplasm.
• GO:0014065 Phosphatidylinositol 3-kinase signaling
  A series of reactions within the signal-receiving cell, mediated by the intracellular phosphatidylinositol 3-kinase (PI3K). Many cell surface receptor linked signaling pathways signal through PI3K to regulate numerous cellular functions.
• GO:0014065 Phosphatidylinositol 3-kinase signaling
  A series of reactions within the signal-receiving cell, mediated by the intracellular phosphatidylinositol 3-kinase (PI3K). Many cell surface receptor linked signaling pathways signal through PI3K to regulate numerous cellular functions.
• GO:0030833 Regulation of actin filament polymerization
  Any process that modulates the frequency, rate or extent of the assembly of actin filaments by the addition of actin monomers to a filament.
• GO:0032869 Cellular response to insulin stimulus
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an insulin stimulus. Insulin is a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms.
• GO:0034976 Response to endoplasmic reticulum stress
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stress acting at the endoplasmic reticulum. ER stress usually results from the accumulation of unfolded or misfolded proteins in the ER lumen.
• GO:0042325 Regulation of phosphorylation
  Any process that modulates the frequency, rate or extent of addition of phosphate groups into a molecule.
• GO:0042993 Positive regulation of transcription factor import into nucleus
  Any process that activates or increases the frequency, rate or extent of the movement of a transcription factor from the cytoplasm to the nucleus.
• GO:0043065 Positive regulation of apoptotic process
  Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
• GO:0045785 Positive regulation of cell adhesion
  Any process that activates or increases the frequency, rate or extent of cell adhesion.
• GO:0045944 Positive regulation of transcription from RNA polymerase II promoter
  Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
• GO:0051492 Regulation of stress fiber assembly
  Any process that modulates the frequency, rate or extent of the assembly of a stress fiber, a bundle of microfilaments and other proteins found in fibroblasts.
• GO:0090003 Regulation of establishment of protein localization to plasma membrane
  Any process that modulates the frequency, rate or extent of the directed movement of a protein to a specific location in the plasma membrane.

Protein Sequence

>O08908
MAGAEGFQYRAVYPFRRERPEDLELLPGDLLVVSRVALQALGVADGGERCPHNVGWMPGFNERTRQRGDFPGTYVEFLGP
VALARPGPRPRGPRPLPARPLDGSSESGHILPDLAEQFSPPDPAPPILVKLVEAIEQAELDSECYSKPELPATRTDWSLS
DLEQWDRTALYDAVKGFLLALPAAVVTPEAAAEAYRALREVAGPVGLVLEPPTLPLHQALTLRFLLQHLGRVARRAPSPD
TAVHALASAFGPLLLRIPPSGGEGDGSEPVPDFPVLLLERLVQEHVEEQDAAPPALPPKPSKAKPAPTALANGGSPPSLQ
DAEWYWGDISREEVNERLRDTPDGTFLVRDASSKIQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVELISHYR
HESLAQYNAKLDTRLLYPVSKYQQDQVVKEDSIEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFNE
TIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQDLRAQASDNREIDKRMNSLKPD
LMQLRKIRDQYLVWLTQKGARQRKINEWLGIKNETEDQYSLMEDEDALPHHEERTWYVGKINRTQAEEMLSGKRDGTFLI
RESSQRGCYACSVVVDGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPGPPSA
AR