Genome3D
Mus musculus

Sh2d1a SH2 domain-containing protein 1A

UniProt Data

Accession O88890 [ UniProt ]
Name SH21A_MOUSE
Description SH2 domain-containing protein 1A
Species Mus musculus
Sequence Length126

Enzyme Annotations (0)

    GO Annotations

    Cellular component (1)

    None predicted

    Molecular function (1)

    None predicted

    Biological process (4)

    • GO:0006959 Humoral immune response
      An immune response mediated through a body fluid.
    • GO:0007267 Cell-cell signaling
      Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
    • GO:0045954 Positive regulation of natural killer cell mediated cytotoxicity
      Any process that activates or increases the frequency, rate or extent of natural killer cell mediated cytotoxicity.
    • GO:0045954 Positive regulation of natural killer cell mediated cytotoxicity
      Any process that activates or increases the frequency, rate or extent of natural killer cell mediated cytotoxicity.

    Protein Sequence

    >O88890
MDAVTVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYQGYIYTYRVSQTETGSWSAETAPGVHKRFFRKV
KNLISAFQKPDQGIVTPLQYPVEKSSGRGPQAPTGRRDSDICLNAP