Genome3D
Mus musculus

Grap2 GRB2-related adaptor protein 2

UniProt Data

Accession O89100 [ UniProt ]
Name GRAP2_MOUSE
Description GRB2-related adaptor protein 2
Species Mus musculus
Sequence Length322

Enzyme Annotations (0)

    GO Annotations

    Cellular component (6)

    • GO:0005634 Nucleus
      A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    • GO:0005634 Nucleus
      A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    • GO:0005737 Cytoplasm
      All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    • GO:0005737 Cytoplasm
      All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    • GO:0005768 Endosome
      A vacuole to which materials ingested by endocytosis are delivered.
    • GO:0005768 Endosome
      A vacuole to which materials ingested by endocytosis are delivered.

    Molecular function (1)

    None predicted

    Biological process (1)

    None predicted

    Protein Sequence

    >O89100
MEATAKFDFMASGEDELSFRTGDILKILSNQEEWLKAELGSQEGYVPKNFIDIEFPEWFHEGLSRHQAENLLMGKDIGFF
IIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYFLWTEKFPSLNKLVDYYRTTSISKQKQVFLRDGTQDQGHRGNSLD
RRSQGGPHPSGTVGEEIRPSVNRKLSDHLPLGPQQFHPHQQPSPQFTPGPQPPQQQRYLQHFHQDRRGGSLDINDGHCGL
GSEVNATLMHRRHTDPVQLQAAGRVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPM
MR