SEM1 26S proteasome complex subunit SEM1

• Overview
• Annotations

UniProt Data

Enzyme Annotations (0)

GO Annotations

Cellular component (4)

• GO:0005634 Nucleus
  A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
• GO:0008541 Proteasome regulatory particle, lid subcomplex
  The subcomplex of the proteasome regulatory particle that forms the peripheral lid, which is added on top of the base subcomplex.
• GO:0034515 Proteasome storage granule
  A multisubunit proteasome complex that localizes in the cytoplasm as dot-like structures when cells are in a quiescent state.

Molecular function (1)

Biological process (13)

• GO:0006406 MRNA export from nucleus
  The directed movement of mRNA from the nucleus to the cytoplasm.
• GO:0006406 MRNA export from nucleus
  The directed movement of mRNA from the nucleus to the cytoplasm.
• GO:0006511 Ubiquitin-dependent protein catabolic process
  The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
• GO:0006887 Exocytosis
  A process of secretion by a cell that results in the release of intracellular molecules (e.g. hormones, matrix proteins) contained within a membrane-bounded vesicle by fusion of the vesicle with the plasma membrane of a cell. This process begins with steps that prepare vesicles for fusion with the membrane (tethering and docking) and ends when vesicle fusion is complete. This is the process in which most molecules are secreted from eukaryotic cells.
• GO:0006887 Exocytosis
  A process of secretion by a cell that results in the release of intracellular molecules (e.g. hormones, matrix proteins) contained within a membrane-bounded vesicle by fusion of the vesicle with the plasma membrane of a cell. This process begins with steps that prepare vesicles for fusion with the membrane (tethering and docking) and ends when vesicle fusion is complete. This is the process in which most molecules are secreted from eukaryotic cells.
• GO:0016578 Histone deubiquitination
  The modification of histones by removal of ubiquitin groups.
• GO:0030447 Filamentous growth
  The process in which a multicellular organism, a unicellular organism or a group of unicellular organisms grow in a threadlike, filamentous shape.
• GO:0035753 Maintenance of DNA trinucleotide repeats
  Any process involved in sustaining the fidelity and copy number of DNA trinucleotide repeats. DNA trinucleotide repeats are naturally occurring runs of three base-pairs.
• GO:0043161 Proteasome-mediated ubiquitin-dependent protein catabolic process
  The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
• GO:0043161 Proteasome-mediated ubiquitin-dependent protein catabolic process
  The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
• GO:0043248 Proteasome assembly
  The aggregation, arrangement and bonding together of a mature, active proteasome complex.
• GO:0051726 Regulation of cell cycle
  Any process that modulates the rate or extent of progression through the cell cycle.
• GO:0072742 SAGA complex localization to transcription regulatory region
  Any process in which a SAGA complex is transported to, or maintained in, a specific location in the transcription regulatory region of a gene.

Protein Sequence

>O94742
MSTDVAAAQAQSKIDLTKKKNEEINKKSLEEDDEFEDFPIDTWANGETIKSNAVTQTNIWEENWDDVEVDDDFTNELKAE
LDRYKRENQ